KEGG   Cryptococcus neoformans JEC21: CNF03190Help
Entry
CNF03190          CDS       T00243                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:cne00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    CNF03190
Enzymes [BR:cne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CNF03190
Protein kinases [BR:cne01001]
 Serine/threonine protein kinases: Other group
  TTK family
   CNF03190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:complement(join(949312..949650,949703..949768,949809..949967,950009..950104,950155..950421,950781..951104,951503..952033))
Genome map
AA seq 593 aa AA seqDB search
MSSPENDRVLDNLWTTEDESFEVQMPDFHFDWGLEKGKTADQGIKAPTASLRSLSINEIT
PPLPSGSSSTSTPPHSTISARSSISSAQILPKRDISNASSSPHIPTPPGSIANPGHRSLS
AQNFANSGGSSGGESSGERGKTYGGRKFQRVVSAPISPENGTDTEGVEFQVSGNVCSTDV
TDPPPQGPPDVYCSSDQAIVSPTATAGCESRLTNISHPDDRPVKPARKPVNQSVHEINES
IHEPMALATQSQAEHGVSRTSAAVPSEGEDRLFRPFGKLEETLRPVNGVPYERLQRLGKG
GSSTVYSVLYSGPKKRIIYALKVVQLDRADSETYQSYTNEIELLKRLRGHDRVIQLIDHQ
ITFNQHNRPHRLLMVMECGEIDFAALLDEQRGKAINMNFVGLYWEQMLEAVQAVHRENVV
HTDLKPANFVLVKGRLKIIDFGIAKAIANDTVNIQRDQQIGTVNYMSPEAIQRMNNQKVL
KLSYPSDVWSLGCILYQMIYGSPPFQHVSGGPLAKMGVIADPNHVVTYPEVAVPKAAVGF
SLDGHPTDPASLSVPVSPSAIDSMKRCLAYRKEHRLTIPELLQHEFLKPRIRG
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgagctcaccggagaacgatcgcgtgctggataatctgtggacaaccgaggacgagtcg
ttcgaagtgcagatgccggacttccattttgattggggattggagaaaggaaaaaccgca
gatcaaggaattaaggcccctacggcgtccttacgctctctatccatcaacgaaatcacc
ccaccccttcctagtggctcttcatccacctctacccctcctcattccaccatatcggca
agatcttcaatatcttctgcccagatattacccaaaagggatatctctaatgcgtcgtca
tcacctcatatacccactcctcctggaagcatcgccaatcccggccatcgatcattatct
gctcaaaacttcgccaattctggaggaagttccggcggggagtctagcggtgaacggggc
aaaacttatggtggccgcaagttccagcgcgtagtgtctgccccaatatcgcccgaaaat
gggacggatacggaaggagtagaatttcaagtttcaggaaatgtttgctcaactgatgta
acagatcccccaccccaagggcccccggacgtttattgttcatcggatcaagcaatcgtt
tccccaactgcgacagccggatgcgaaagtcggttgacgaacatatcacatccagacgat
cgaccagtaaaaccagcgcgcaaaccggtaaaccaaagcgtacatgaaataaatgaatca
attcacgagccgatggctttagctactcaatcgcaagcggaacatggggtatcacgtaca
tcggcggccgtaccttcagaaggagaggacagactatttcggcctttcggtaaactggaa
gaaactctgcgacctgtgaacggagtcccatacgaaagattacaacgcttgggaaagggc
ggctcgtcgactgtttattctgtcctttattcgggtcctaaaaaaagaatcatctatgct
cttaaggtagtacaactcgaccgtgcggactccgaaacatatcaaagctacacaaacgaa
atcgagcttttgaagcgtctccgtggacacgatcgtgttattcagctcatcgatcatcaa
ataaccttcaaccaacataatcgccctcatcgtttgctgatggtcatggaatgcggcgag
attgattttgcagcgttgctagatgagcaacgggggaaagcaattaatatgaactttgtc
ggtttatattgggagcaaatgcttgaagctgtccaagccgtccaccgcgagaatgttgtt
catacagatttgaaaccggcgaactttgttctcgtgaaggggcggttgaaaatcattgat
tttggcattgcaaaagcaatagcaaatgacactgtcaatattcagcgcgatcagcaaatt
ggcaccgtaaactacatgtcacctgaggctattcaaagaatgaacaatcagaaggtattg
aagttatcctatcccagcgatgtttggtcacttggttgtatcctttaccaaatgatttat
ggtagccccccctttcaacatgttagtggaggaccactggcgaaaatgggtgtgatcgca
gatcccaaccacgtcgtcacatatccagaagtggctgtacccaaggcagcagttggattc
agtcttgatggtcatcctacagaccccgcaagtctatcagtccctgtcagcccgtccgcc
attgattcaatgaagcgatgcctagcatatcgcaaagagcatcgactgacaatacctgaa
ttattgcaacatgagtttctaaagccaagaataagaggttag

DBGET integrated database retrieval system