KEGG   Cryptococcus neoformans JEC21: CNF03620Help
Entry
CNF03620          CDS       T00243                                 

Definition
Beta-hexosaminidase precursor (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CNF03620
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    CNF03620
   00603 Glycosphingolipid biosynthesis - globo series
    CNF03620
   00604 Glycosphingolipid biosynthesis - ganglio series
    CNF03620
   00511 Other glycan degradation
    CNF03620
Enzymes [BR:cne01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CNF03620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:join(1062994..1063662,1063713..1063889,1063942..1064196,1064244..1064378,1064436..1064570,1064627..1064712,1064771..1064823,1064871..1064896,1064949..1065045,1065107..1065211,1065273..1065295)
Genome map
AA seq 586 aa AA seqDB search
MLFSGLLEVLTSSLPFLAPSSPLSAKPDINVVPLPRHYIIGDGSTPVCLSTNFSIQAAPS
SLATFPTDLQDAITSTQHRLKNTQVTYLSPNEGSEFFTGGSGAIRSCAYYLDTLHIDFTA
YNGTDILSETVAPVEERAELEAYTLDLSLKGKATISSRGALGAFRGLSTFEGLFYSLEAG
VQGSDRVYAPLAPYHIEDKPSFGWRAVLLDTSRHYFSVPSILKILDTMSMVKLNVFHWHV
TDSNSWPLDLDSYPELAAKGASSQSERYSQKDMQMIIDYAGHRGIDTLLEIDTPGHTASI
APSHPSFVACFESTPFKHFAHQPPAGQLRFADEKVTEWTAQLLREIGSLSKGGYFSTGGD
EINMNCMLEDMPTASKLKAKGWTLDDALDHFTEKTHAPLRQAGKTPVVWQEMALNHGTMS
SLTNDTIVDIWVNSADARKVLDQGYRIVHASADYFYLDCGQGGWIGEEGGNNSWCDPMKS
WARMYSFDPFKDVKDEERHLVLGGQTSLWTEQTDETNLEPTLWPRAAALAEVFWSGPGPD
SRPRSSNKALPRMHDIRYRMVGRGVRAAPLQPRWCALRPGACILAA
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgctcttcagtggcctgctcgaagttctcacctcgtctctaccgttccttgctccttcg
tctcctctttcggccaaacccgatatcaatgtcgtccctttgcctaggcattacatcatc
ggggatgggtcgacgcctgtttgtctttctaccaatttcagcatacaagcagccccctca
tctttagccactttcccgactgaccttcaagatgccatcacatcaactcaacaccgcttg
aagaacacccaggtaacgtatctttcgcccaacgaaggatcagagtttttcaccggcggc
tctggtgctattagatcttgcgcatactatctcgacaccttgcacattgatttcactgcc
tataatggtaccgatatcctctcggaaaccgttgcacccgtcgaagaacgcgccgagctc
gaggcatatacgcttgatctctctctcaaggggaaagcgacgatcagctctcgaggggct
ttgggtgcgttcagaggtctcagcaccttcgaaggcctcttctacagccttgaggctgga
gttcagggatcggacagagtgtatgctccactcgctccttatcatattgaagacaagcca
agttttggctggcgtgcagtattattggatacctcgaggcattacttttccgttccatcc
atcctgaagatactggatacgatgtccatggttaagctcaacgtcttccactggcacgtc
acggactccaattcatggcctttagatcttgacagctatccagaactcgcagccaaagga
gcatcctctcagtctgagaggtatagccagaaagatatgcaaatgatcattgactatgca
ggccacagaggcattgacacccttctcgagattgacacaccgggccacactgcctctatt
gctccttcgcatccctccttcgtggcatgcttcgagtcaacgccattcaaacactttgct
caccagcctccagcaggacaattgcgatttgccgacgagaaggtgacagagtggacggct
cagctcctgcgggagatcggcagtctgtccaaaggaggatatttcagtacgggaggggat
gagatcaatatgaactgcatgttggaagatatgcctacggcgtctaagctgaaagccaaa
ggctggacgttggatgacgccttggatcattttactgaaaagacacatgcccccttgagg
caggcaggaaaaactccagtggtctggcaagagatggcgctcaatcacgggacgatgtct
tctcttactaatgacaccattgttgatatctgggtcaactctgcggacgctcgcaaggtt
ctggaccaaggataccgtatagtccacgcttcggcagactacttttacctggactgtgga
caaggcggatggataggggaagagggaggtaataacagctggtgtgatcccatgaagtct
tgggcaagaatgtattctttcgaccctttcaaagatgtcaaagacgaagagaggcacttg
gttttgggtggtcaaacatcgctctggacagagcagacggacgagacgaacttggagcct
actctctggcctagagcagcagctttagcggaagttttctggtcagggccaggaccagac
agccgacctcgcagttcaaacaaggcgctacctagaatgcacgatatccgttatagaatg
gtgggaagaggtgtgagagctgcacctttgcagcctcgttggtgcgcccttcgtcccggt
gcgtgtattttagctgcttga

DBGET integrated database retrieval system