KEGG   Cryptococcus neoformans JEC21: CNF03740Help
Entry
CNF03740          CDS       T00243                                 

Definition
phosphatidylinositol 3-kinase TOR1
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
cne  Cryptococcus neoformans JEC21
Brite
Protein kinases [BR:cne01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   CNF03740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:complement(join(1088803..1088818,1088875..1089052,1089106..1089346,1089399..1089488,1089548..1089814,1089870..1090117,1090171..1090552,1090608..1090964,1091018..1091359,1091408..1091689,1091742..1091934,1091998..1092108,1092157..1092767,1092819..1092962,1093021..1093410,1093459..1094094,1094141..1094380,1094429..1094882,1094934..1095171,1095230..1095503,1095565..1095865,1095918..1096020,1096069..1096602,1096656..1096802,1096849..1096920,1096976..1097154,1097205..1097257))
Genome map
AA seq 2360 aa AA seqDB search
MSSQSDVLDNIFQRLSARSEDVRAQAGQDLAEHVVAYTQEYPGHDASKGVWAQVFHKTFE
FTRSNNQLERLGAIISISQLLQLTKDDTLDRAQQKVLRLYEYLRPLTTCGDSTVMLPASL
VVEDMVRNSPTLHTDTFLGKEVGQALVMIDDSRQEVGRFSGALLLYAFARAAPGVFHQYI
PKVLEKIWVPLRDSRSVVRERASMLLSTCLDTLKTRGDRPSTDTYRKIFEEARLGLLKAS
STESILGSLLAFNSMLQNQQLSMAEYYRSICELTFKYRDSKEVSIRKAVIALIPSMATYD
SDDFEAHYLHRSMAYLLQALNRPADRDISYVALGHMAVHLGSKMKPFIDDIMRIIRDHLR
MRGKKNAPYEAPIFQCLAMLATSVGPMLTRQMHEILNLMFPWGLSEPLCTALQATASHIP
PLLRTIQDRLLEMLSQTLTGHSYRPLGAPAPRGGAQMDLNLLQSTTNAQSADTLKLALRL
LARFDFVGHTLSEFVRDAALPYLEHDSVEVRREAVLATTTLFMTDPICQQTSSNSVEIVN
DVLSKLLTVAITDPNAGIRRTVLDHLEDKFDRHLAQADDIRCLFIALNDEVFGNRERTIS
IIGRLAHHNPAYVMPHLRKSLINIVTELEYSTNARQKEESAKLLCLIIGAAAGLVKSYAP
TILSVLLRTASSPDSSIGVQAECLKCIGELARVAGEELVPSVRAILDLVIEMLNDQASPA
KRDTALKTLGQIASNTGEVIKPYTDYPQLMGVLFRFLRMEANSSVRQETIKTIGMLGALD
PFKHKTLLGDVDDPIDEGTTSRVNDIVLLNQHNSSVNDEFFQTVVIHSLVNVLHDSTYKD
HYQAVEAIMMIFRTQRLRCVNFLPQIVPAFLNVIRIAHSSRTELYLKQLAQFITIVKLHI
RNYLNDVFDLIHEFWNPNSTLQITIISLVEAIAKAVEGEFKAYLPKLLQQILRSFDGDLS
AKHLPELKLNTLLQILKAFYVFGESIEDYLHLVLPVIVRSFENPAAPDSLRIAALRTTGQ
LCRKVNFSDHASQIIHPLVRTLGNSSEELRQTAMETLCVLVLQFGPDYAIFIPMVNKALV
ENKISHPGYEALITQLLNRERLPPDLGPVERYASDSAVEASAPEPVALKVNQQALKLAWD
CSHLLNTSSRTEWISWIIGLGHEMMRESPSQAIRAARSLALSSVAFTKELFNVAFYSCWQ
ELFESYQEDLWHNLDRAIKKDDVPGDVVNMILGATQFLEHDEKEVAIESRVLGSVAANYQ
ALAVALHYKEQEFFLDPSKEVIEDLIDVNQKLQQSDAAWGTLEWAQTEMGMTTEVEWYEK
LGRWEEALQVWNERDADASTTFSEWEITEGKVTCLHAMGEWEQLSDFVQARWANRTAEEK
KLLSPLAAAASWSLKQWDLMDDYISAMKGDGADRAFFKAILAVHRNQIPAALKQISKARE
RLDPELTTLTGDSYGRAYDTVVRIQMLAELEEIIAYKDHADEPARQEMQRQTWKKRLAGC
QRDVEVWQRILQVRSLVLKPNEDMDTWIEFADLCRTSDRLNLAEKTLTSLVGFQYPSMED
TRGRAPPPIIFAYLRMAWAKNLQIDSREERYETLQHLRDFTDQLTDDVGIGARGPNGRLM
LPDQKLYGSYTKLLAQCHVELGQWQATLRESQGSADPSGILHDYSLATELDPEWYQAWHT
WALANFEVITQLEVSQQGLSPIHFTTYIIPAVEGFLKSISLSPGNSLQDTLRLLTLWFTY
GYSSGVTAAVSQGLPTVNIDVWLEVIPQIIARIQTPRQSIQQLIVQLLHDIGKAHPQALI
YPLTVASKSTVAARRTVAQNITHKMREHSPKIVDQAELVSTELIRAAILWHEMWYDGLEE
ASKHYFGDHDIPGMLGVLEPLHEIVENGPQTLRETSFIQSFGHDLRIAREHLKRYRITQD
GTEIQQAWDVYYSVFQRLGKQLKLLNVIELQYVSPKLMAVRDLDIAVPGTYQSGKPIIGI
KNVIPTFKVIASKQKPRQCSMRGMDGKEYAYCLKGHEDLRQDERVMQLFGLVNTLLNNDH
ESAKRHLSIQRFSVTPLSPSAGLLGWVTHSDTIHVLIKQYRDQRKILVDIEHKLMQQMSD
ESYDSLPLLHKVEIFQYALDNTTGQDLYRILWLKSRNSDIWLERRTTYTRSLGLNSMVGY
ILGLGDRHPSNLLLDQITGKMVHIDFGDCFEVAQQRDKYPEKVPFRLTRMLIHAMEVCGI
TGNFSRSCEVSMEVLRDNRESLMAVLEAFVYDPLIAWRLTATDKRPGGVGEVKDLDDPAV
YGKQRKNKANETEILNDVENTEVKNDKGLQVIERVRRKLTGRDFKPDVVLDVKSQVEKLV
VEATKTENLCVAFLGWCSFW
NT seq 7083 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcacaatcagacgttctcgacaacatctttcagcgtctgtctgccaggtcggag
gatgtccgcgctcaggccggtcaagatcttgcagagcacgtcgtagcttatacccaggaa
tacccgggacatgatgcttcgaagggtgtatgggcacaggtctttcacaagacattcgag
tttactaggagcaacaatcagctagaaagattaggtgcaattatttccatctcgcaattg
ttacaactaacgaaggatgacacactggatcgtgctcaacaaaaggttctacgcctctat
gaatatcttcggcctctcacaacatgcggcgattcgaccgtcatgcttcccgcctcgctc
gtcgttgaagatatggtccgcaattcccccacccttcacaccgatactttccttggcaaa
gaagttggacaagcgctggtaatgattgacgactcacgtcaagaagtcggtcgtttcagt
ggtgctcttcttctctatgctttcgcccgtgctgcccccggagtattccatcaatacatc
cccaaggtcttggaaaagatttgggttccccttcgcgactcaagatctgtcgttcgagaa
cgtgcgagcatgctcttatctacctgccttgacactctcaaaacccgaggagaccgacca
tcaaccgacacctaccgcaagatctttgaagaggcccgtcttggtctcctcaaagccagc
tcaacagagtctatcttgggttctctccttgctttcaattccatgcttcaaaatcaacag
ctttcgatggcggaatattatcgctccatttgcgaactaaccttcaaataccgtgattcg
aaggaagtttccatcaggaaggctgtcatcgccctcataccttctatggcgacatatgat
agcgacgactttgaggcacattatttgcataggagtatggcgtatttgctacaagcgttg
aacaggccggcggacagggacatttcgtatgtggcattgggtcatatggccgtacatctt
ggatcgaaaatgaaaccttttattgacgacattatgcggatcattcgagatcatctacgc
atgcgaggcaaaaaaaatgctccatacgaagcccccatcttccagtgtcttgcgatgctc
gctacctctgtcggccctatgcttacccgccagatgcacgaaatcctcaacctgatgttc
ccctggggcctttcggaacccttatgtacagcccttcaagccactgcctcacatatccct
cctctattgaggactatccaagataggttgttggagatgctttcacagactttgaccgga
cacagctatagaccgttaggtgcgcctgccccaagaggtggagcgcagatggatcttaac
cttttgcaatctacaaccaatgcccagtcagcagacaccctaaaacttgctcttcgtctc
cttgcgcgctttgattttgtcggccatacccttagcgagtttgtccgtgacgctgctctt
ccgtatctggaacacgacagtgtcgaggtccgacgtgaagccgtgttggcgaccacgacc
ctgttcatgacggacccgatctgtcaacagacgagcagtaattcggtcgagattgtaaat
gatgtgttgagtaaattgttaaccgtagccattaccgatcctaatgctggaatccgccgg
acagtgctcgatcacctcgaagacaagtttgatcgccatctcgctcaggctgacgatatc
cgatgtctctttatcgctctcaacgatgaagtttttggtaatcgtgagaggactatctcg
atcattgggagattggcacaccataacccggcttatgtgatgcctcatttgagaaagagt
ttgatcaatattgtcactgagttggagtattctaccaatgcgcgacaaaaggaagagagt
gccaagctgctctgtcttataatcggcgctgccgcaggtctcgtcaagtcttatgcccct
accatcctatccgttcttctccgcactgcttccagccccgattcttctatcggtgtccaa
gccgaatgcctcaaatgtattggtgagcttgccagagttgcgggcgaagaactcgtcccc
tccgtccgagccattctcgacctcgtcattgaaatgctcaatgaccaggcttcccccgcc
aagagagatactgccctcaagactttagggcagattgcgagtaacacaggagaagttatc
aaaccctatacggattaccctcagttgatgggggtgctgtttaggtttttgagaatggag
gcgaattcgagtgtcaggcaagagacgatcaagacgattggtatgctcggtgccttggat
ccctttaagcacaagactttgttgggtgatgtggacgaccctatcgacgaagggacaacc
tcgcgagtcaatgacattgtgttgctcaaccaacacaactcttcagtcaatgacgagttc
ttccagactgttgtcatccattctttagtcaacgtcttgcatgactctacttacaaggat
cattatcaagccgtggaagcaattatgatgatttttaggactcaacgattgagatgtgtc
aacttcctccctcagatcgtccctgcattcctcaatgtcattcgcattgcacattcctct
cgtaccgagctttacctcaaacaacttgcgcaatttattacaatcgttaaactgcatatc
cgcaactacctcaatgatgtctttgatctaatccacgagttctggaaccccaactctact
cttcaaattaccatcatctccctcgttgaggccatcgcgaaggctgtggaaggtgaattc
aaggcatacttgcccaagcttttgcagcagattttgagatcgtttgatggagacttgtca
gccaagcacctcccggagctgaaactcaacactttgcttcagattctgaaagccttctac
gtctttggcgaatctatcgaagactacctccaccttgtcttgcccgtcattgttcgatct
tttgagaacccggccgcccccgattctctccgcattgctgctttgcgcactacaggacag
ctttgtcgtaaagtcaacttttcggaccatgcgagtcagatcatccacccgttggtaaga
actttgggtaatagctcagaggagttgaggcagactgcaatggaaacactttgcgttttg
gtgttgcagttcggcccagattatgctatcttcattcctatggtaaacaaagctttggtg
gaaaacaaaatatcacatcctggttacgaagcgctcataacccaattgctcaaccgcgag
cgccttcctccagatcttggccctgtcgaacgatacgccagtgactctgccgtcgaagcc
tctgccccagagcctgttgctcttaaggtcaaccagcaggctcttaaactggcctgggac
tgttcccacttgcttaacaccagcagcaggaccgagtggatctcttggattattggcttg
ggtcatgagatgatgagagaaagccctagtcaagccataagggccgcaaggagtttggcg
ttgagtagtgtggccttcaccaaggaacttttcaatgttgctttctactcatgctggcag
gagctgtttgagagttaccaggaggatttatggcataatcttgaccgagcaatcaagaaa
gatgatgtccccggcgatgttgtcaatatgattctcggggccactcagttcttggagcat
gatgaaaaggaagtagctatcgaaagtcgtgttttgggcagtgtcgctgccaattatcaa
gctctcgcggtcgctttacattacaaagaacaggaattcttcctggaccctagcaaggaa
gtcatcgaagacctcattgacgtcaaccagaaactccagcaaagcgatgccgcctggggt
acccttgaatgggctcagacagagatgggtatgactactgaggtcgagtggtacgaaaag
cttggaaggtgggaggaagcgttacaagtgtggaacgagcgagatgccgatgcttcgacc
actttctcagagtgggagatcactgaaggcaaggtcacttgtctgcacgctatgggcgaa
tgggaacaactctccgactttgtccaggctcgatgggccaacaggacggcagaggagaaa
aagttgctctcgccgttagcggcagcagctagttggtcgctgaaacaatgggatctgatg
gacgattacatctccgccatgaagggcgacggagcggatcgcgcgttcttcaaggctatc
ttagctgtgcacagaaaccaaatccctgctgctttgaagcaaatctccaaggcgcgagaa
aggctggatccagagttgactaccttaactggtgacagctacggccgagcgtacgatact
gtcgtgaggattcaaatgcttgctgagcttgaggaaatcattgcctacaaggatcacgcc
gacgagcctgcccgacaggagatgcaacgacagacttggaagaagcgtttggctggatgt
cagcgcgatgtcgaagtttggcagcgcattcttcaggtcagatcccttgtactcaagcct
aatgaggatatggacacttggattgagtttgcggacctctgtcgaacatctgacaggctg
aacttggccgagaaaacgctgacatctcttgttggcttccaatacccatcaatggaagac
actcgaggacgagcaccacctcccatcattttcgcttacctacgtatggcctgggcgaag
aaccttcaaatcgactctcgagaagaacgttacgaaactctccaacacttgcgagacttc
acggaccagcttaccgacgatgttggtatcggagcgaggggccccaacggcagactcatg
ttacctgaccagaagttgtatggatcttacaccaagctgctggcgcagtgccatgttgaa
ttgggtcagtggcaagcgactttgagggaaagccaaggatctgctgatccctcgggcatt
ctccacgactattctctcgccactgaacttgaccctgagtggtaccaagcttggcacact
tgggctttggccaatttcgaagttattacccagcttgaagtatcacagcaaggtctctca
cctattcactttacgacctatatcatccctgctgtcgaaggtttcctcaagtctatctcg
ctttctcctggcaactccttgcaagatactttaaggctgctgactctctggtttacatat
ggatactctagcggagtgacagcggccgttagccaaggtctgcccactgtcaacattgat
gtctggctcgaggtcatccctcagattattgcccgtatccaaacgccacgccagtctata
cagcagctcattgtacagctcttgcatgatattggcaaagcccatcctcaagcccttatc
taccctcttaccgtcgcctccaaatctacagtcgcagcccgacgcactgttgctcaaaat
atcacccataaaatgcgagagcactctcccaagatcgttgaccaggccgagcttgtcagt
actgagctcatccgagcggctatcttatggcatgagatgtggtatgatggtttggaagaa
gcgtcaaagcactactttggtgaccatgatatccctggcatgctgggagttcttgaacct
ttgcatgagattgtcgaaaacggaccccaaaccttgcgtgagacgtcctttattcaatcg
ttcgggcatgatttgcgtatcgcccgagagcatctcaagcgttaccgtataactcaggat
gggaccgaaattcaacaagcatgggatgtctactactccgtcttccagcgtctcggcaaa
cagctcaagctcctgaacgtcattgagctgcaatatgtctcgcccaagttgatggccgtt
cgagacttggatattgctgttccaggtacctaccagagtggcaagcctatcatcggtatt
aagaacgttatcccgaccttcaaggtcattgcttccaagcaaaagccaagacaatgcagc
atgcgcggtatggatggtaaagaatatgcgtactgcctcaagggtcacgaggacttgcga
caagacgagcgtgttatgcagctcttcggtttggtcaacactcttcttaataatgatcac
gagtctgccaaacgacatctcagtatccagcgattttctgttactcctctttcccctagt
gccggtttactcggttgggttacccacagtgataccatccacgtcctcatcaaacaatac
cgagaccaaaggaaaatcttggtggatattgagcacaaacttatgcagcagatgtctgat
gagagctacgattctctgccgctcttgcacaaggtcgagatcttccagtatgccttggat
aacacaactggtcaggatttgtaccgcatcttgtggctcaagtctcgtaactcagatatc
tggcttgagagaaggaccacctacactagaagtctgggtctcaactcgatggtcgggtat
atccttggcctgggtgacagacatccttcaaacctgttgctcgatcagattacgggtaag
atggtgcacattgactttggtgattgtttcgaggttgctcaacagagagacaagtaccct
gagaaagtaccgttccgacttacccgaatgctcattcatgccatggaggtctgcggtatc
actggcaacttttcgcgaagctgtgaagtgtccatggaagtccttcgtgacaacagagaa
tcacttatggccgtgcttgaagcatttgtgtacgatcctcttattgcttggcgtcttacg
gcgacggacaaacgacctggtggcgttggcgaagtcaaggacctggatgacccggcggtg
tacggaaagcagaggaaaaacaaggcgaacgagacagagattctcaatgatgtagaaaat
accgaggtgaagaatgacaagggtctgcaggtcattgaacgagtacgacgaaaattgacc
ggtcgagattttaagcccgacgttgtactcgatgtcaagtcccaagtggagaaattggtg
gttgaggcgacaaagacagagaacctgtgtgtggcgttcttgggatggtgttccttctgg
taa

DBGET integrated database retrieval system