KEGG   Cryptococcus neoformans JEC21: CNF03800Help
Entry
CNF03800          CDS       T00243                                 

Definition
ubiquitin specific protease
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
cne  Cryptococcus neoformans JEC21
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:join(1112188..1112415,1112469..1112631,1112684..1112920,1112976..1113223,1113276..1113369,1113418..1113501,1113552..1113901,1113956..1114217,1114279..1114412)
Genome map
AA seq 599 aa AA seqDB search
MATPQSRIFDRTDTSICPHLSALLSIPSASSRNPGTSGAKGNTLGFPPGSKGAEIEKRFV
DVVKWGALPQGVKRRKTMSPGCHTCKTPLSRPWACLTCPYVGCMPLVGKGANEKDCMKRH
WKSSGRKCAFAVDPSTGTIFCEACGDTTYPDTFESLFLTTRIRVEESNDHSREPGLVGGK
GRGRGEWKSWNPNNIAALNEREVVRTSCRGLRPLLNLSQTCFLSAVLQALVHNPLLKAYF
LSDKHNRHVCTNGGKGLLVGKPFLGVENGPGAVGSDRERGCMCCEMDKAFEEFYNEDKSP
FGPITMLYAMWHASTELEGYGQQDAHSFFLAALDQIHAHAKGQLSSCNCIAHQTFAGSLQ
SSVICSKCSKTSNTVDPILDIQLDFPPPSVPSSASSSSDSSAFGPSTNGQADQLTLAGML
RKFCAPERVGDPGGNGYECSGCGGGVGVVAMRKLGVKKLAPVLSFQLKRFAHSSATTSVK
IESHVRFPSTLDMRPYVDSSSSSKSGNDRKEKELPDSLYIYDLFAVVTHEGKLDNGHYWA
DVRDGEEWWHCDDDKVTPTSLSAVLAQRAYMLFYVKRSIAYAQPMSRLLAGGSTGTNGA
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atggcgacccctcaatcccgcatatttgacaggactgacacatctatatgccctcatttg
tccgctcttctcagcataccgagcgcctcttcaagaaaccctggcacatcaggagccaaa
gggaacactctagggtttccaccgggatccaaaggagctgaaattgagaaaaggttcgtg
gacgttgttaaatggggagctttaccgcaaggtgtcaagcgacggaagaccatgtctccg
gggtgtcatacttgcaaaactcctctttccaggccatgggcgtgccttacttgcccatac
gttggctgtatgccgcttgtgggcaaaggagctaatgagaaggattgtatgaagagacat
tggaagagcagcggaaggaaatgtgcttttgctgttgatccctctactggtaccatattt
tgtgaagcttgtggggatacaacatatcctgatacttttgaatcacttttccttactact
cgaatccgcgttgaagagtcaaacgatcattcacgcgaaccaggtttggttggtggcaag
ggaagggggagaggcgagtggaaatcgtggaacccgaacaatattgcggcgctcaatgag
agagaggtggtgaggacaagttgtcgtggtctacggccccttcttaatttatctcaaaca
tgtttcctctcggccgtccttcaagcacttgttcataatccgcttctcaaagcatacttc
ctctcagacaaacacaatcgacatgtgtgcacaaacggtggcaaaggccttttggtcggg
aagccgttcttaggtgtagagaacgggccaggtgcagtgggaagcgatagagagagggga
tgcatgtgctgcgagatggataaggcttttgaagagttctataatgaggacaagtcgcct
tttggacctatcacaatgctctacgccatgtggcacgcgagcacagagctcgagggttac
ggtcagcaagatgcccattctttctttcttgctgcgctggaccaaatccatgctcatgcc
aagggtcagctatccagctgtaactgcattgcccatcaaacctttgcgggctccctccaa
tcttccgttatctgctctaaatgctccaagacctccaacactgtcgatccaattcttgac
atccagctcgacttcccacctccgtctgttccttcatcagcatcctcatcctccgactca
tcggcttttggcccgtccaccaatgggcaagcggatcaactaacattagcgggcatgtta
cgcaagttttgtgcgccagagcgtgttggagatcctggagggaacggatacgagtgttct
ggatgtgggggcggcgtgggcgtagtggccatgagaaaattgggagtgaaaaagcttgct
ccagtgttgtcattccaactcaagcgttttgcccattcatccgccactacgtccgtcaag
atcgaatcccatgtccggttcccatccaccctcgatatgcgtccttacgtagactcttcc
tcatcttctaaaagtggcaatgacagaaaggagaaagaattaccagactcgctgtacata
tacgatctgttcgcagttgtcactcatgagggcaagctggacaatgggcattattgggcg
gatgtgagggacggcgaggagtggtggcattgtgatgatgataaggtcactcctacatct
ctctctgctgtattggcgcagagagcgtacatgcttttttacgtcaaacgatccatagcc
tatgcccagccaatgtcgaggttgttggctggcggcagcactggtaccaacggtgcttaa

DBGET integrated database retrieval system