KEGG   Cryptococcus neoformans JEC21: CNG00050Help
Entry
CNG00050          CDS       T00243                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cne00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:join(10659..10739,10808..11489,11542..12059,12118..12205,12262..12569)
Genome map
AA seq 558 aa AA seqDB search
MVKRLLQGLNLGAGLAVKWYAFVFLRLLPAGPRYLPTILSCTLMYLASYFSLRSLAQKPI
RTSIITPILVLGGLYHPMYRLLSTVGALVTLIAPLMSYDFVYRTHLLHPSLHISFARVGW
VTETSASLLFRSTFPDRIGVSYWPSHNDSAVSHVGLSQSSVKTDFTSPLYIKNLQPGITY
FYNSTAGHKGSFTTRRSQHDQKQFSILSTSCQKPNWPYNPLSHSLAINGLEHVDNVVRKM
KRKPEAMLFLGDFIYSDLPYPIADYTTSYYRRLYRQIYSSPSWTPFLRSIPWLHMFDDHE
IINDYAPSTSALSNMFIEAIDPFINYQQVVNPPPVSSTQPTYFRFGIGDVSFFVLDCRSW
RSAQPARPGSNSTAGFGNRTMLGESQFTAVKEWAEEGTRDGKLLVLVSGVPITRNWSEGD
DEMDSWAGYLDEREEILEMLWSSGGAVVISGDRHEHATTLFPPPPTSPHLSSSSVIEFST
SPLSFFHQPWTREYVPHPDTDIPIHLQWQGDSRFGVFEFDTTGERPRVKFELMVDGEKEW
EYEWVKGVDVVIPDVWQA
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagagattattacaggggctgaatttgggtgctggcttggcggtgaaatggtat
gccttcgtatttctacgcctgcttcccgctggacctcgatatctcccaactattttgagc
tgtactttaatgtacctcgcatcttacttctcacttcgctcccttgctcaaaaaccaatt
cggacgtcgattatcacgcccatcctagttcttggtggactttaccatcccatgtatcgt
cttctctcgacggttggtgctttggtcaccttgatagctccgcttatgtcgtacgacttt
gtctaccgcacccatttactacatccgtcactacacatatccttcgctcgggttggctgg
gtaacagaaacgtcggccagcctcttatttcgatctaccttcccagatcgaatcggcgta
tcctattggccttctcacaatgacagcgccgtctcacatgtcggactttctcaatccagt
gtcaaaaccgacttcacttctcctctgtacatcaaaaatctgcaaccgggcatcacatac
ttttataactcgactgccggccacaaaggttcgttcactactagacgatcacaacatgat
cagaagcaattcagcattctgagtacaagctgccaaaagcccaactggccctataatcct
ctgtctcattcgttggcaattaatggtttagaacatgtcgataacgtggtccgaaaaatg
aagagaaaaccggaagcgatgctgttcttaggcgacttcatctattcagacctcccatat
cccatcgccgactataccacttcgtactatcgccgactttaccgccagatctactccagc
ccatcttggaccccatttctgcgttcaatcccctggctacacatgtttgacgaccacgag
atcatcaacgactacgccccttccacttctgccctttccaacatgttcatagaagccatc
gatccgttcataaactatcagcaagttgtcaaccctcccccggtcagctccacacaaccg
acgtacttccgctttggaataggcgatgtatcattcttcgtcttggactgccgatcatgg
cgttcagctcaaccagctagacctggatccaattctacagctggctttggcaacaggacg
atgcttggagaatcacaatttacggcagtcaaagaatgggcagaagaagggacgagagat
ggaaaattactggtgcttgtatcaggagtaccgattactcgcaattggtcggaaggggat
gatgagatggacagttgggctggttatcttgacgaacgtgaggagattcttgaaatgttg
tggtcgtccggaggagccgtcgtcatctccggcgatcgacatgagcacgcaaccacatta
ttccctcctccgcctacgtcgcctcacctgagctcatcgtccgtcatcgagttctccacc
tctcctttgtcattttttcaccaaccttggacccgagaatacgtcccacatccggacact
gacattcccatccatctgcaatggcaaggtgatagtcgctttggtgtgttcgagtttgat
accactggagaaagaccgagagtcaagtttgaattgatggtagatggtgagaaagaatgg
gagtatgagtgggtaaaaggggtagacgtggtaattccggacgtatggcaggcgtaa

DBGET integrated database retrieval system