KEGG   Cryptococcus neoformans var. neoformans JEC21: CNG00550Help
Entry
CNG00550          CDS       T00243                                 

Definition
(RefSeq) arginase
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    CNG00550
   00330 Arginine and proline metabolism
    CNG00550
Enzymes [BR:cne01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     CNG00550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
7:join(145705..145911,145970..145989,146049..146463,146520..146668,146736..146941,147002..147043,147091..147149,147208..147306)
Genome map
AA seq 398 aa AA seqDB search
MLSRVSPSLRQVLAAPLRASRMGTSPMQKAFTHSSAPRNHHITAQPSSEKGLTSPTYNYK
FLNEPATASLVGCPFSGGQGRAGVDLAPNKLVSAGLVEQISALGWNVHYESHQNFLDIPY
NPLPSSSPVTSTEGPSTHTTTAQGEKMVQRLPDPDIGSMKKPRLVSAVNEMVAKEVGDIA
EKGWLPVTLGGDHSLAMGTIAGTKRKYPNAGVIWVDAHADINTPLTTESGNLHGCPVSFL
LGLDGCDVEPFNKWLKPCLKPEDIVYIGLRDIDDAEKKILKENNIKTFTMHHVDRHGIGK
VMELALQHINPNGDRPLHLSFDVDALDPTVAPSTGTPVRGGLTFREGHYITEVVAETGCL
VALDIMEVNPSLLDPRSVEMTVAAGCSLTRASLGETLL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgctctctcgcgtctctccatctcttcgtcaagtccttgctgccccattgagggcatca
aggatgggcacttcccctatgcaaaaagcgttcacccactcatcagcacctagaaaccat
catattaccgctcagcctagtagtgagaagggtcttacctcccctacttacaattacaag
tttttgaacgagcctgctactgcttctcttgtcggatgcccttttagcggtggacaaggt
cgagctggtgtcgatctcgccccaaacaagctcgtctctgccggtcttgtagagcaaatc
tcggcccttggctggaacgtccattacgaatctcaccaaaacttcctcgacatcccttac
aacccccttccttcttcttcccccgtcacttcaaccgaaggcccctctacccacactacg
accgctcagggcgaaaagatggtccagaggttgccggatcctgatattggaagcatgaaa
aaacctaggttagtcagtgcggtgaacgaaatggtagccaaggaggttggggatatcgcg
gagaaggggtggttgcctgtgactttgggaggcgaccacagtttggcgatgggtactatt
gctggtactaagcgcaagtaccctaacgctggtgtgatctgggttgatgctcacgccgat
atcaacacccccttgaccaccgagtctggcaatctccacggctgccctgtttctttcctc
ttgggtttggatggctgtgacgtcgagcctttcaacaagtggcttaaaccttgcctcaag
cctgaagatatcgtctacatcggtctccgggacattgacgacgccgagaagaagattctg
aaggaaaataacatcaagactttcactatgcaccacgtcgacaggcacggtattggcaaa
gtcatggaacttgcgcttcagcatatcaaccccaatggtgaccgaccccttcacctcagt
ttcgacgttgacgctcttgaccccacagttgctcctagcacaggtacccccgttcgaggt
ggtctgactttccgagaaggccattacattaccgaggttgttgctgagaccggctgcctc
gtcgctttggacatcatggaggtcaacccttccctgcttgaccccaggtccgtcgagatg
actgtcgctgctggctgttccctcacgcgggcatctttgggtgagactttgttgtaa

DBGET integrated database retrieval system