KEGG   Cryptococcus neoformans JEC21: CNG00550Help
Entry
CNG00550          CDS       T00243                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CNG00550
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CNG00550
Enzymes [BR:cne01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     CNG00550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:join(145705..145911,145970..145989,146049..146463,146520..146668,146736..146941,147002..147043,147091..147149,147208..147306)
Genome map
AA seq 398 aa AA seqDB search
MLSRVSPSLRQVLAAPLRASRMGTSPMQKAFTHSSAPRNHHITAQPSSEKGLTSPTYNYK
FLNEPATASLVGCPFSGGQGRAGVDLAPNKLVSAGLVEQISALGWNVHYESHQNFLDIPY
NPLPSSSPVTSTEGPSTHTTTAQGEKMVQRLPDPDIGSMKKPRLVSAVNEMVAKEVGDIA
EKGWLPVTLGGDHSLAMGTIAGTKRKYPNAGVIWVDAHADINTPLTTESGNLHGCPVSFL
LGLDGCDVEPFNKWLKPCLKPEDIVYIGLRDIDDAEKKILKENNIKTFTMHHVDRHGIGK
VMELALQHINPNGDRPLHLSFDVDALDPTVAPSTGTPVRGGLTFREGHYITEVVAETGCL
VALDIMEVNPSLLDPRSVEMTVAAGCSLTRASLGETLL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgctctctcgcgtctctccatctcttcgtcaagtccttgctgccccattgagggcatca
aggatgggcacttcccctatgcaaaaagcgttcacccactcatcagcacctagaaaccat
catattaccgctcagcctagtagtgagaagggtcttacctcccctacttacaattacaag
tttttgaacgagcctgctactgcttctcttgtcggatgcccttttagcggtggacaaggt
cgagctggtgtcgatctcgccccaaacaagctcgtctctgccggtcttgtagagcaaatc
tcggcccttggctggaacgtccattacgaatctcaccaaaacttcctcgacatcccttac
aacccccttccttcttcttcccccgtcacttcaaccgaaggcccctctacccacactacg
accgctcagggcgaaaagatggtccagaggttgccggatcctgatattggaagcatgaaa
aaacctaggttagtcagtgcggtgaacgaaatggtagccaaggaggttggggatatcgcg
gagaaggggtggttgcctgtgactttgggaggcgaccacagtttggcgatgggtactatt
gctggtactaagcgcaagtaccctaacgctggtgtgatctgggttgatgctcacgccgat
atcaacacccccttgaccaccgagtctggcaatctccacggctgccctgtttctttcctc
ttgggtttggatggctgtgacgtcgagcctttcaacaagtggcttaaaccttgcctcaag
cctgaagatatcgtctacatcggtctccgggacattgacgacgccgagaagaagattctg
aaggaaaataacatcaagactttcactatgcaccacgtcgacaggcacggtattggcaaa
gtcatggaacttgcgcttcagcatatcaaccccaatggtgaccgaccccttcacctcagt
ttcgacgttgacgctcttgaccccacagttgctcctagcacaggtacccccgttcgaggt
ggtctgactttccgagaaggccattacattaccgaggttgttgctgagaccggctgcctc
gtcgctttggacatcatggaggtcaacccttccctgcttgaccccaggtccgtcgagatg
actgtcgctgctggctgttccctcacgcgggcatctttgggtgagactttgttgtaa

DBGET integrated database retrieval system