KEGG   Cryptococcus neoformans JEC21: CNG00600Help
Entry
CNG00600          CDS       T00243                                 

Definition
mannitol-1-phosphate dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:cne01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cne00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:cne00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:cne00350]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(join(160201..160267,160326..160977,161038..161169,161282..161699))
Genome map
AA seq 422 aa AA seqDB search
MMTISSRRISTFTTALKSIVTRLPPNSTHIRPISTRLSAPFLHHPSISATTSRIIHTTRA
NMSTLSNFTIPKTQIAAVVKTTGAELAIDKEHPVKQASELRPGECLVKISHTGVCHTDLH
AKSGDWPIPPSHPLIGGHEGVGTIVAIGDHTAASPVKLGDRVGIKWLADSCLSCELCRRG
YEMNCPNVKLSGYTTDGTFSEYVVSFVNHVTPIPESLDSAGAASILCAGVTTYKALKVSN
TKVGDWVALPGAGGGLGHLAVQYAKAMGLKVVAIDTGAAKEKLVKSLGADAWVDFKTSKD
IVADIKAATGGDGPAAAVVTAANKTGYSQAIEYLKPSGTLVAVGMPDAEMGANVFWTVFK
SIRIQGSYVGNRQDAIEALDIAASGHVRVVFEEKGLESLKDVYEDLEAGKIAGRVVLKVS
DE
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgatttcttccaggcgaatctcgaccttcaccacagccctcaagtccattgtt
acccgtttgcctccgaactcaacgcatataagacccatctccacacgtctttctgcccct
tttcttcaccatccatctatatccgcaaccacatcacgtattatccatacaacccgagca
aacatgtctactctctctaacttcaccatccccaaaacccagattgccgctgttgtcaaa
actaccggcgctgagctcgcgattgacaaggagcaccctgtcaagcaggcctcggagctc
aggcctggcgaatgtttggtcaaaatctcccacactggtgtctgccataccgacttgcac
gccaagtctggcgactggcctattcccccatcccatcctcttatcgggggtcatgaaggt
gtcggtactatcgtcgctattggtgaccatactgctgcttctcccgtcaagctcggtgat
cgagtcggtatcaagtggctcgccgacagctgtctcagctgtgagctttgtcgacgcggc
tatgagatgaactgtcccaacgtcaagctctctggctataccaccgacggtactttctcc
gaatacgtcgtctccttcgtcaaccatgttactcctattcccgaatccctcgactctgcc
ggggccgcctccattctctgtgctggtgtcaccacctacaaggctctcaaggtctccaac
accaaggtcggtgactgggtcgctcttcccggcgctggcggtggtctcggtcatcttgcc
gtccaatatgcaaaggccatgggtctcaaggtcgtcgctatcgatactggcgctgccaag
gagaagctcgtcaagtctctcggtgctgacgcttgggtcgactttaaaacttccaaggat
attgtggccgacatcaaggccgctactggcggtgacggtcctgccgccgctgtggtcacc
gctgccaacaagacgggttactctcaggcaatcgagtacttgaagcctagcggtaccctt
gtggctgtcggtatgcctgacgctgagatgggcgcaaacgttttctggacagtgttcaag
agcattaggatccagggtagctacgtcggtaacagacaggacgcgattgaggcacttgat
atcgctgcgtctggccacgtcagggtcgtctttgaagagaaaggtcttgaatcgttgaag
gacgtttacgaggaccttgaggctggtaagattgctggccgagttgttctcaaggtttcc
gacgagtaa

DBGET integrated database retrieval system