KEGG   Cryptococcus neoformans JEC21: CNG00600Help
Entry
CNG00600          CDS       T00243                                 

Definition
mannitol-1-phosphate dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CNG00600
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CNG00600
  Lipid metabolism
   00071 Fatty acid degradation
    CNG00600
  Amino acid metabolism
   00350 Tyrosine metabolism
    CNG00600
Enzymes [BR:cne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CNG00600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(join(160201..160267,160326..160977,161038..161169,161282..161699))
Genome map
AA seq 422 aa AA seqDB search
MMTISSRRISTFTTALKSIVTRLPPNSTHIRPISTRLSAPFLHHPSISATTSRIIHTTRA
NMSTLSNFTIPKTQIAAVVKTTGAELAIDKEHPVKQASELRPGECLVKISHTGVCHTDLH
AKSGDWPIPPSHPLIGGHEGVGTIVAIGDHTAASPVKLGDRVGIKWLADSCLSCELCRRG
YEMNCPNVKLSGYTTDGTFSEYVVSFVNHVTPIPESLDSAGAASILCAGVTTYKALKVSN
TKVGDWVALPGAGGGLGHLAVQYAKAMGLKVVAIDTGAAKEKLVKSLGADAWVDFKTSKD
IVADIKAATGGDGPAAAVVTAANKTGYSQAIEYLKPSGTLVAVGMPDAEMGANVFWTVFK
SIRIQGSYVGNRQDAIEALDIAASGHVRVVFEEKGLESLKDVYEDLEAGKIAGRVVLKVS
DE
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgatttcttccaggcgaatctcgaccttcaccacagccctcaagtccattgtt
acccgtttgcctccgaactcaacgcatataagacccatctccacacgtctttctgcccct
tttcttcaccatccatctatatccgcaaccacatcacgtattatccatacaacccgagca
aacatgtctactctctctaacttcaccatccccaaaacccagattgccgctgttgtcaaa
actaccggcgctgagctcgcgattgacaaggagcaccctgtcaagcaggcctcggagctc
aggcctggcgaatgtttggtcaaaatctcccacactggtgtctgccataccgacttgcac
gccaagtctggcgactggcctattcccccatcccatcctcttatcgggggtcatgaaggt
gtcggtactatcgtcgctattggtgaccatactgctgcttctcccgtcaagctcggtgat
cgagtcggtatcaagtggctcgccgacagctgtctcagctgtgagctttgtcgacgcggc
tatgagatgaactgtcccaacgtcaagctctctggctataccaccgacggtactttctcc
gaatacgtcgtctccttcgtcaaccatgttactcctattcccgaatccctcgactctgcc
ggggccgcctccattctctgtgctggtgtcaccacctacaaggctctcaaggtctccaac
accaaggtcggtgactgggtcgctcttcccggcgctggcggtggtctcggtcatcttgcc
gtccaatatgcaaaggccatgggtctcaaggtcgtcgctatcgatactggcgctgccaag
gagaagctcgtcaagtctctcggtgctgacgcttgggtcgactttaaaacttccaaggat
attgtggccgacatcaaggccgctactggcggtgacggtcctgccgccgctgtggtcacc
gctgccaacaagacgggttactctcaggcaatcgagtacttgaagcctagcggtaccctt
gtggctgtcggtatgcctgacgctgagatgggcgcaaacgttttctggacagtgttcaag
agcattaggatccagggtagctacgtcggtaacagacaggacgcgattgaggcacttgat
atcgctgcgtctggccacgtcagggtcgtctttgaagagaaaggtcttgaatcgttgaag
gacgtttacgaggaccttgaggctggtaagattgctggccgagttgttctcaaggtttcc
gacgagtaa

DBGET integrated database retrieval system