KEGG   Cryptococcus neoformans JEC21: CNG03680Help
Entry
CNG03680          CDS       T00243                                 

Definition
ubiquitin carboxyl-terminal hydrolase 12 (EC:3.1.2.12)
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
cne  Cryptococcus neoformans JEC21
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:join(1033961..1034534,1034596..1035657,1035710..1036134,1036181..1036378,1036425..1037642,1037695..1037953,1038013..1038143,1038195..1038800)
Genome map
AA seq 1490 aa AA seqDB search
MGAGGRVLLVREFSSAALSPAGCRPPTPPRHCLSSFHSISAPSFLLFLYPKSARVPTDIP
TKGHFENLFMSSQDLPGTLKRPRSTSRPPSPSSGSSPKRAASEDPFPSSSDSGRVFDHLI
TDNGGMVAASSPLRQDIGDNESNKSWVELTQQVKLGSDGEEDVEGDTTLRTEGRFFLVSQ
EVWKERNNELLGLLPPPFNHYERYYILPKSIVQKVQLLALGDANDIAVQPEDFAEAMKEL
VPDHSAESFWVIQSEKTVAGHKLIGKAKKEDVWALGDAEENEDYVFVPETGWQKVLEWFG
PYDGPSLPRYCVPPDNIEIIPANLRLFIVLPADAITTAGQPDESIQSVLLAPSTTPIKTF
ESFAVSVCNQEIDRSKLAGQWATRLWKIEKSGENDESLLKSGSLEITPKALISTKCQLID
TSSAEENLAEAILGSSKSQIIAIEFGKIPEGSSTPVWNVEVNNDKQAVEKSNKPPPLFSK
PAFFSGSGKAASESASTTDAIQTRSQTRERKGKGLVGLQNLGNTCFMNSAVQCLSNTKEL
SQYFLSGVYTEELNRDNPLGMQGQIAEAFGQVVENLWAPTSSMHSSYSPRQLKWTTSRFA
PQFAGYGQHDTQEFIAFLLDGLHEDLNRILKKPYIEKPDWKPGGGDKELAELGKECWDGY
KKRNDSVIVDLFQGQLKSTLVCPECHKESITFDPFMYLTVPLPIAQNRQFKITFVPRDTE
KPPVNVKLLIPQNASFAQVKDKIGSLFDCKGSSIVGFDLWNNRPYAWWADSDHNSEAKDT
DEAIFYELDPSVSVSVPRGKFGSQPRTTSQDGSLTVPVYTFRTVENSRGGYRAGDVPSDL
SLKPFFITLTKAEASDPNAVREAIMRGYTRFMKPEAKENIYVPASSAQAKAPTPPKSDDG
EPGTEIHMSGDQATVVEVPSSRQSPAIGAEEPGEGAPMELDSASASTSAVTGIQLSGSTT
SLLSTNSIRSSISLSGKLVPRADLFKVYVADPTGDFSFKSFRSNEKKYDAAHLYDKDITS
ASKSWSLLESRKKKAKKHIVNRLASGISSMVNPSNNSDDEVLSDGSTSTSPNKLEKMKEK
LTNSKLAVRPGEGIFCEWSGADFAEWLNDNVKGEDVIDPAISKELVKKREGKHIGIEDCL
DEFSKEETLGQDDLWYCPVCKKHQAATKKLEIYKAPDILVICIKRFGSSRRMGDKLDNLV
HFPIDGLDLEDRIGERQVAKTLKLNGEDVEGYGIEDDGEPLLYDLYAVDNHFGGMGGGHY
TAFCRNQVDNQWYNYDDSRVSKADVSSVQSRAAYLLFYRRRTNRPIGGESRIKAEEAARN
VPSASASPDAGPSTESSTMPSTAFVSARTTPTRDLSPATFSDELPSYSQVPSPPTLDTSA
PPSPTVSDDSFPVTGTYSQGVDIASVGQSIGFGNTAWGSPAKVPESGHSFGTMTRAEWLD
PPAQSVDMGRMSTNMDVEEDRSDVLTALQGDEGDEGTRGTKDEDVEMELQ
NT seq 4473 nt NT seq  +upstreamnt  +downstreamnt
atgggcgctggcggaagagtgctgctggttcgagaattttcttccgctgctctctcacct
gctggctgccgtccccccaccccgccgcgtcattgcttatcctctttccactccatctcc
gctccttcttttcttcttttcctctatcctaaatccgccagagtgcccacggacataccc
acaaaagggcactttgaaaacctcttcatgtcgtcccaagacttacccggcacactcaaa
cggccacgctccacttcgcgccctccttccccatcctccggctcgtccccaaaaagagca
gcttccgaagatccatttccttcaagttcagactcgggacgcgtgttcgaccatctcatt
actgataacggcggcatggtagccgcttcaagcccgctgaggcaggatattggcgataat
gagagcaacaagagctgggttgagctcacccagcaagtcaagctcgggtcagatggcgaa
gaggatgtggaaggtgatactaccttgagaacagaagggagatttttccttgtgtcccag
gaagtttggaaagaacggaacaatgagcttttaggcttacttcctcctccattcaaccac
tacgagagatactacattctccctaagtccattgtccagaaggttcagctccttgccctt
ggcgacgccaacgacattgcggttcagcctgaagactttgcggaagctatgaaggagctc
gtgcctgatcattcagccgagtctttctgggtgatccagtctgaaaagactgttgcaggt
cacaagcttattggaaaagccaagaaggaggatgtttgggcgctgggagatgcggaagag
aatgaggactatgtgtttgtgcccgaaactggctggcaaaaagtacttgaatggtttggc
ccgtacgacggaccttccttacctcgctattgcgtcccccctgataatatcgagatcatt
cctgcaaaccttcgacttttcattgtcttgcccgctgacgccatcactaccgctggtcaa
cccgatgaatctattcagagtgttcttttggctcctagcaccactccgatcaagactttt
gagagctttgctgtctctgtctgtaaccaggagattgaccgtagcaaactcgctgggcaa
tgggctacccgtttatggaagattgaaaagtcaggcgaaaatgatgaaagtctcctcaag
tctgggtctcttgaaatcactcccaaagcgcttatttctaccaagtgccagcttattgac
acttcgagtgccgaagaaaaccttgcagaggctattttaggcagttcaaagtcccagatc
attgctatcgaatttggcaagatccccgaaggatcctctactcccgtctggaacgtcgaa
gtcaacaacgataagcaagcagttgagaaaagtaataagcctcctcctcttttctccaag
cctgccttttttagtggatccggaaaagcagctagcgagtccgcttctactacggatgct
atccagactaggagtcaaaccagagaacgaaagggcaagggtctggtcggtttgcaaaat
ttgggcaacacctgtttcatgaatagtgctgtgcaatgtctgagtaacaccaaggagctt
tcccaatacttcctctccggtgtatacaccgaagagcttaatcgtgacaatcctctcggc
atgcaaggtcaaatcgccgaagcctttggccaagtagtcgaaaacctctgggctcctact
tcttctatgcatagctcctactctccccgccagctcaaatggactacttccaggttcgcc
cctcagttcgctggttatggacagcacgacactcaagagttcattgcattcttactggat
ggtttgcatgaggacttgaataggattttgaagaagccatatatcgagaaacccgactgg
aagcctggtggtggtgacaaggagttggctgagcttggaaaggaatgctgggatgggtac
aaaaagaggaacgacagtgtcattgtcgacttgttccaagggcagttgaagagtaccttg
gtttgtcccgaatgtcacaaggaatccatcacctttgatccgttcatgtaccttacagtg
cctctgcccattgcgcagaacagacagttcaagatcacctttgtccctcgagacaccgaa
aagccacctgtcaatgtcaagcttttgatccctcaaaatgcctcattcgctcaggtcaag
gataagattgggtcactgttcgactgcaagggttctagcatcgtcggcttcgacctctgg
aataaccggccttacgcttggtgggccgactcggaccacaacagtgaagctaaagacacc
gacgaagctatcttttacgaactcgacccatccgtctccgtttccgtgcccagggggaaa
ttcggttcccaacctcgaacaaccagccaagatggctcattaactgtccccgtttacacc
ttccgaactgtcgaaaactctcgaggcggctatcgagcgggcgatgtcccttctgatctc
tctctcaagcccttctttattacccttactaaggctgaggcgtctgaccccaatgccgta
agggaggctatcatgcgcggttacacacgattcatgaagcccgaagcaaaggagaacatt
tacgtccccgcctctagtgctcaggctaaggctcctactccacccaagagcgacgatggg
gagcctgggacagagattcacatgagcggtgaccaggctactgtcgtagaggtcccttca
tcccggcagtcgcccgcgattggcgccgaagagcccggggagggtgctcccatggaattg
gactctgcttctgcctccacgtcggcagtgactggcatccagctcagtggatctacgact
tcccttcttagcaccaactccatcagatcttctatttctttatccggcaaactcgtgccc
agagcagatcttttcaaagtttatgttgctgatcccactggtgatttctcctttaagagc
ttcagatcgaacgagaagaagtatgatgctgctcatctttacgacaaggatatcacttcc
gcctctaagagctggtctttgctcgagtctcgcaagaagaaggcgaagaagcatattgtc
aaccgacttgcttccggtattagctccatggtcaacccttccaataactctgacgatgaa
gtgctgtccgatggatctactagcacatcacctaacaagctggagaaaatgaaggaaaag
ttgaccaactccaagctagcagtaaggccaggagaaggtattttctgcgagtggtcgggg
gccgactttgccgaatggctcaatgataatgttaagggcgaagatgttatcgatcctgcg
atttccaaggaattggtcaagaagagagaggggaagcacattggtattgaggattgttta
gacgagttctcaaaggaggagaccctcggtcaagacgacttgtggtactgccctgtctgc
aagaagcaccaagctgccaccaagaagctggaaatctacaaggctcccgatatccttgtt
atttgtatcaagcgattcggttcttcgcgacgtatgggcgataagctcgataacctggta
cacttcccgattgatgggctcgacttggaagacaggattggtgagaggcaggtggccaag
actttgaagctcaatggagaagatgttgagggatatggtatcgaagatgacggtgaacct
ctgctttatgacctttatgctgtcgacaaccacttcggtggaatgggcggaggccactat
actgccttctgcaggaatcaagtggataaccagtggtacaactatgatgattctcgagtc
tccaaggccgatgtttcttcagttcagagccgtgccgcctatttgctgttctaccgaaga
agaaccaaccgacctatcggcggcgaatccaggatcaaggctgaagaagccgctcgcaat
gtgccatccgcttctgcttcccccgacgccggaccatccaccgagtcatccaccatgccc
tccacagcctttgtttccgcccgtacgacccctacacgggatctttcacccgctacattc
tcagacgagctcccttcgtactcgcaagtgccctctccacctacactcgatacatccgcg
ccccctagccctacggtcagcgacgattccttccctgtaacgggcacatatagtcaagga
gtcgatatcgcctctgtaggccaatcaattggatttggaaacactgcatggggttcgcct
gccaaggtaccggaaagtggacattcgtttgggacgatgactagggctgagtggctggat
cctccggcgcaatctgtagacatggggcggatgtctacgaatatggatgtggaggaggat
aggtctgatgtattgacggcactccaaggtgacgaaggtgacgaaggtacacgggggacc
aaagatgaggatgtggaaatggagttacagtag

DBGET integrated database retrieval system