KEGG   Cryptococcus neoformans JEC21: CNG03820Help
Entry
CNG03820          CDS       T00243                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cne00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(join(1073595..1074923,1075029..1075469))
Genome map
AA seq 589 aa AA seqDB search
MLCMYLLSTPAGGGGPPLSVSTRDAFSNRRSQRLDRIYFVPITSFLLATSFAIPKTMSPP
PKHITILGGGLSGLSTAYHLSRVLPASTKISLVEGTSRVGGWIDSQKHELGFKDQRGQMR
EGVVGIETGPRSIRPRGSRGAASMLKMLEDLGLENDIMPIPFSHPSAQNRFLLDYSTSKL
TALPSSLTSFLGRQPPLLKGLLSAGLFEPLKPKAPRKHLTADKDESVDAFFRRRFGDNVA
DNLASAMVHGIYAASSSQLSLRSAFPSLWEAERKYGSVVIGMLLGTKTAAEKAEEKREWE
ELGEVGKEREKWSLYGIKGGLGTMTDKLLDRISSRGVEIILGEPVRKIELSSNQEIAIHT
HSHSLSTSHVISALPPRVLARTLSSPLPHLTHNPSTCVGVVNVVYPLPPTSIHSAGFGYL
VPRPPTNLNPNPSPNPSGVLGVIFDSTALPPNPPELGGQVTKLTLMMGGPYWANYSPRIS
PPSDPEELLPLAIQHLNTIFPHLRNVKPILAVCNIHHNCIPTYLPGHGARLREMHEAIES
GEWNGKLSLVGSGYGGVGVNDCVLPGVDVARRLAKGKEVTGLEAWKDWE
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgtatgtatcttctatcaacacctgccggtggagggggacctccactttccgtt
tccacccgtgacgcattttccaaccgacgaagtcagagactcgaccgtatatattttgtt
ccaatcacctcatttctattggctacttcttttgcaatccctaaaacgatgtccccccca
ccaaaacatataacaatcctcggaggtggcctctcaggcctctcgactgcctaccacctg
tcccgtgtccttccggcgagtaccaaaatctccctggtcgagggcacatcaagagttggc
gggtggatcgattctcagaaacatgaactggggttcaaggatcaaagggggcaaatgaga
gagggggtggtgggcatcgagactgggcctaggagtatacggcctagaggaagtagagga
gcggcaagcatgctgaagatgttggaagatctcgggctggagaacgatatcatgcctatc
ccgttctctcatccatctgctcaaaatcgattcttactggactactccacttcgaaacta
acggcgctcccctcttcccttacatcttttcttggccgccagccacctcttctcaaaggt
cttctctcagcaggtttatttgaacctctcaaaccaaaagcaccaaggaaacatctgact
gctgataaagatgagtctgtggatgcattcttccgcagacgatttggcgataatgtggcg
gacaacctggcctcagctatggttcatggtatctatgccgcctcttcttcgcagctttcc
ctcagatcggcttttccctcactgtgggaagcagagaggaagtatggttctgtggtaatt
ggcatgctgctaggaactaagacagcggcggagaaggctgaggagaagcgagagtgggaa
gagttgggagaagtaggcaaggagagggaaaaatggagtttgtacggcatcaaaggtggt
ttgggcacaatgacggacaaactactggacagaatttcgtcccggggtgtggaaatcatc
ttaggggaacctgtacgcaagattgagctttcctcaaaccaggaaattgctatccacacc
cacagccactccctttcaacttcccacgtcatctccgccctacctcccagagttcttgct
cgcaccctctcttctcctttaccccaccttacacacaatccctccacatgcgttggagtt
gtcaacgtcgtatatccccttccacccacatccattcactctgcaggcttcggctatctt
gttcctcgtccacccaccaacctcaacccgaacccgagcccgaacccctcgggggtcctc
ggtgtcatcttcgactcaacagctttaccccccaaccctcctgagctgggtggacaggtg
acgaagctcacattgatgatgggtggtccgtactgggcaaactactccccgcgaatctca
cctcccagtgacccggaagaactcttaccactcgccatccaacacctcaataccattttc
ccgcatcttcgaaacgtcaagcctatcttggcggtctgtaacattcatcataactgtatt
cctacgtatcttccagggcatggcgctcgtttgcgcgaaatgcatgaggcgattgagagt
ggagaatggaatgggaagttgagcttggttgggagcggatacggtggagtgggtgtgaat
gattgcgtgcttcctggggtggacgtcgctaggagattggcgaaggggaaggaagtgaca
ggattggaagcgtggaaggactgggagtga

DBGET integrated database retrieval system