KEGG   Cryptococcus neoformans JEC21: CNG04540Help
Entry
CNG04540          CDS       T00243                                 

Definition
ubiquitin carboxyl-terminal hydrolase 6 (EC:3.1.2.15)
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
cne  Cryptococcus neoformans JEC21
Brite
Enzymes [BR:cne01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CNG04540
Peptidases [BR:cne01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CNG04540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(join(1292115..1292332,1292386..1292605,1292671..1292731,1292779..1292853,1292909..1293085,1293136..1293568,1293629..1293695,1293749..1293784,1293851..1293888,1293941..1294045,1294100..1294124))
Genome map
AA seq 484 aa AA seqDB search
MPKSQNMELSVKHSGKTYTVPVTQETTTQAFKDAISQLTRVPTERMKVMVKGKLVKDDTD
YVALANQKQSVMVIGAAEALPPPPTQQIVFLEDVGDEGIKSDEPTGLINLGNTCYLNSTL
QAIRAMPEVHQALKEFTPSSSSSSSLPEFRVTNSLKNLFVTIDNTPNAVPPLEVISNLRI
LAPQFAERDQRGHYAQQDADEAWTQLVQALRAALPKNGDEGSVVDRLMSIELTKTLKNAE
TEEEPETTSTETVLKLECNISGTTNFLMSGIQDNLNQQVEKTSATLGRNATYSMQSRVSR
LPEYLVVHMVRFYWRRDIQKKAKIMRKVKFPLELDLSDIVTEPLRKKIQPLNTATKQILK
ERDARANILKRKPGQGLDEEEKKRGEEKAMVEELVKEGGLTSGEGSGMYELAAVVTHKGA
SADSGHYIGWSRVDNGACVPAEQQRWAKFDDNNVTFTDANKILSMDGGGEDSVAYILLYR
AAKI
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaatctcaaaatatggaactcagcgtaaaacattctggcaagacgtacaccgtt
cctgtcacacaagagaccacgactcaggctttcaaggatgctatctctcaacttaccagg
gtccctactgagaggatgaaggttatggtgaagggcaagctggtgaaggatgatacagat
tatgtcgctttggcaaatcaaaagcaatctgttatggtaattggagcagctgaagcgtta
ccaccaccaccaacccagcaaatcgtctttttggaagatgtaggggatgaaggcattaaa
tccgacgaacccacgggtctcatcaacctcggcaacacatgttacctcaactccacgctc
caagccatccgcgctatgcccgaagtccaccaagcgctcaaagaattcactccttcctcc
tcctcctcttcttccctccccgaattccgcgtcacaaattcgttgaaaaatctgtttgtt
acgattgacaatacacctaatgccgttcctccattggaagttatcagtaatttgagaatc
ttggcgcctcaatttgcagagagggatcagagggggcattacgcacagcaggatgcggat
gaggcttggacgcagcttgtgcaagcgttaagggcggcgttgccgaagaacggggatgaa
gggtctgttgtggaccgtttgatgtctatcgaattaaccaagactctcaaaaatgcagag
acagaggaagaaccagagacaactagtacggagactgtcttgaaactggagtgtaacatc
tctgggaccacaaatttcttgatgtctggtattcaagacaaccttaaccagcaggttgag
aagacgagcgcgacactgggacgaaacgcaacttactctatgcaatctcgcgtttctcga
ttgccggagtaccttgtagtgcacatggttcgattttattggcgtcgtgacatccagaaa
aaggcaaagatcatgcgtaaagtcaagtttccactcgaactcgacttatctgacatcgtg
accgagcccctccgcaaaaagattcaaccccttaacacggcgacgaaacaaatcctcaag
gaacgtgatgcccgtgcgaatatcttgaaacgaaagcccggacagggattggatgaagaa
gaaaagaaaagaggtgaagaaaaggctatggtggaagagcttgtgaaagaagggggacta
accagtggagaggggagtggaatgtacgagctcgctgctgtggtaacacacaaaggcgcc
tctgccgattccggccattatattggctggtctcgcgttgacaatggcgcatgtgtccct
gccgaacaacagagatgggccaagttcgacgataacaatgtaactttcacagatgcgaac
aagatcttgtcaatggatggaggtggtgaggattcagtagcttatattttgctttatcgg
gcggcgaaaatctag

DBGET integrated database retrieval system