KEGG   Cryptococcus neoformans JEC21: CNH00530Help
Entry
CNH00530          CDS       T00243                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CNH00530
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CNH00530
Enzymes [BR:cne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     CNH00530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:join(1032978..1032983,1033046..1033088,1033137..1033327,1033396..1033506,1033555..1033650,1033699..1033793,1033841..1033920,1033972..1034212,1034263..1034865,1034914..1034983)
Genome map
AA seq 511 aa AA seqDB search
MSGKSKFTPLTIVIKLGTSSIVSPTYPFVPHLRLLSSIVETVVKLRTQGHRVVLVSSGAI
GVGLRRMDLKERGKGLHQKQALAAVGQGRLIALWDNLFSQLDQPIAQILLTRMDISDRTR
YLNAQNTFSELLQMGVIPIVNENDTVSVSEIKFGDNDTLSAISSAICHADYLFLLTDVDC
LYTDNPRTNPDAKPVRVVRDIEKVKQQVSTSTLGTSLGTGGMSTKLIAAELATAAGTTTV
VMHSINVTDIFKVIENGPSPCREVAETPELFEGPLCTRFLRRESALKDRKWWIAHGLHAA
GTVVIDEGACRAIRRKESGGRLLPAGVVRVVGPFASHQAVRLVVRRRRHDDIAALSSVDE
STPGSPTPDLSQVPQPATFASPALRHLTIGTTNPITVMSDANNTEPDTPQLQPSMSLSSS
IASLDPLSRSVPPSPAITALAERLGTTSLTSIGRGVAEGESDEWEEVEVAKGLAQYNSVE
IDRMKGRKSSEIEKLIGYVESEHVVDSITFL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgtccggtaaatcaaaattcacccctctgactatcgtcattaagctcggtacctcatct
attgtatccccgacatatccttttgtcccccaccttcgacttctttcatctattgttgag
actgtagtgaaactccggacccaaggacatcgtgtcgtcttggtatcttcgggtgctatc
ggtgtggggttaaggaggatggatcttaaggaaagagggaaggggttgcatcagaagcag
gcccttgctgctgttggtcaagggcggctgattgcgctgtgggataatctgttttctcaa
ttggatcagcctattgcccagattcttctcacccgaatggacatttcagacagaacgcgt
tatctcaacgctcaaaacactttctctgaattattgcaaatgggcgttattcctatcgtc
aatgagaatgatacagtctcagtatctgaaatcaaatttggcgacaatgacacattatcg
gcgatctcttctgctatctgccatgccgactatctcttccttttgactgacgttgactgt
ttatacacagacaacccccgtaccaaccccgatgcgaagcctgtgagagtcgtacgcgat
attgagaaggtgaaacagcaagtatctacttctaccctcggaacatctcttggcacagga
ggcatgtccacaaagctcattgcggccgagcttgctaccgctgctggcacaaccaccgtt
gttatgcattctatcaacgtaactgacattttcaaagtcattgaaaacggcccttcgcct
tgccgagaggttgcagagactccagaattgtttgagggcccactgtgtacgaggttttta
agacgagagtcagcccttaaagaccgaaaatggtggatcgcccacggtcttcacgctgcc
ggtaccgttgtcatcgacgaaggtgcctgccgtgccattcgacgcaaagaatccggtggt
cgtcttcttcctgccggtgtcgtccgcgtggttggccctttcgcaagtcaccaagccgtc
cgtctcgttgttcgccgtcgacgccacgacgacatcgctgcccttagctcagtcgacgaa
tcaacccccggtagccctacccccgacctttcccaagtaccccagccggcgacattcgct
tctcctgctcttcgacaccttacgattgggactaccaatcctatcaccgtcatgtccgac
gccaacaacactgaacctgatactcctcaactccaaccttccatgtctctttcatcgtcg
atcgcttccctcgaccctttgagcaggagtgtgccccctagtcctgcgataacggctttg
gcggagaggttgggcacgacatcgttaacgagtattgggcggggagtggccgaaggagag
agtgatgagtgggaagaggtcgaggtggcgaagggtctagctcaatacaacagtgtagaa
attgacaggatgaagggacgaaagagttcggaaattgaaaaacttattggatacgtcgag
agcgagcatgtggtggactcgattaccttcttgtag

DBGET integrated database retrieval system