KEGG   Cryptococcus neoformans JEC21: CNH00530Help
Entry
CNH00530          CDS       T00243                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cne01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cne00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:join(1032978..1032983,1033046..1033088,1033137..1033327,1033396..1033506,1033555..1033650,1033699..1033793,1033841..1033920,1033972..1034212,1034263..1034865,1034914..1034983)
Genome map
AA seq 511 aa AA seqDB search
MSGKSKFTPLTIVIKLGTSSIVSPTYPFVPHLRLLSSIVETVVKLRTQGHRVVLVSSGAI
GVGLRRMDLKERGKGLHQKQALAAVGQGRLIALWDNLFSQLDQPIAQILLTRMDISDRTR
YLNAQNTFSELLQMGVIPIVNENDTVSVSEIKFGDNDTLSAISSAICHADYLFLLTDVDC
LYTDNPRTNPDAKPVRVVRDIEKVKQQVSTSTLGTSLGTGGMSTKLIAAELATAAGTTTV
VMHSINVTDIFKVIENGPSPCREVAETPELFEGPLCTRFLRRESALKDRKWWIAHGLHAA
GTVVIDEGACRAIRRKESGGRLLPAGVVRVVGPFASHQAVRLVVRRRRHDDIAALSSVDE
STPGSPTPDLSQVPQPATFASPALRHLTIGTTNPITVMSDANNTEPDTPQLQPSMSLSSS
IASLDPLSRSVPPSPAITALAERLGTTSLTSIGRGVAEGESDEWEEVEVAKGLAQYNSVE
IDRMKGRKSSEIEKLIGYVESEHVVDSITFL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgtccggtaaatcaaaattcacccctctgactatcgtcattaagctcggtacctcatct
attgtatccccgacatatccttttgtcccccaccttcgacttctttcatctattgttgag
actgtagtgaaactccggacccaaggacatcgtgtcgtcttggtatcttcgggtgctatc
ggtgtggggttaaggaggatggatcttaaggaaagagggaaggggttgcatcagaagcag
gcccttgctgctgttggtcaagggcggctgattgcgctgtgggataatctgttttctcaa
ttggatcagcctattgcccagattcttctcacccgaatggacatttcagacagaacgcgt
tatctcaacgctcaaaacactttctctgaattattgcaaatgggcgttattcctatcgtc
aatgagaatgatacagtctcagtatctgaaatcaaatttggcgacaatgacacattatcg
gcgatctcttctgctatctgccatgccgactatctcttccttttgactgacgttgactgt
ttatacacagacaacccccgtaccaaccccgatgcgaagcctgtgagagtcgtacgcgat
attgagaaggtgaaacagcaagtatctacttctaccctcggaacatctcttggcacagga
ggcatgtccacaaagctcattgcggccgagcttgctaccgctgctggcacaaccaccgtt
gttatgcattctatcaacgtaactgacattttcaaagtcattgaaaacggcccttcgcct
tgccgagaggttgcagagactccagaattgtttgagggcccactgtgtacgaggttttta
agacgagagtcagcccttaaagaccgaaaatggtggatcgcccacggtcttcacgctgcc
ggtaccgttgtcatcgacgaaggtgcctgccgtgccattcgacgcaaagaatccggtggt
cgtcttcttcctgccggtgtcgtccgcgtggttggccctttcgcaagtcaccaagccgtc
cgtctcgttgttcgccgtcgacgccacgacgacatcgctgcccttagctcagtcgacgaa
tcaacccccggtagccctacccccgacctttcccaagtaccccagccggcgacattcgct
tctcctgctcttcgacaccttacgattgggactaccaatcctatcaccgtcatgtccgac
gccaacaacactgaacctgatactcctcaactccaaccttccatgtctctttcatcgtcg
atcgcttccctcgaccctttgagcaggagtgtgccccctagtcctgcgataacggctttg
gcggagaggttgggcacgacatcgttaacgagtattgggcggggagtggccgaaggagag
agtgatgagtgggaagaggtcgaggtggcgaagggtctagctcaatacaacagtgtagaa
attgacaggatgaagggacgaaagagttcggaaattgaaaaacttattggatacgtcgag
agcgagcatgtggtggactcgattaccttcttgtag

DBGET integrated database retrieval system