KEGG   Cryptococcus neoformans JEC21: CNH00550Help
Entry
CNH00550          CDS       T00243                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:cne00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    CNH00550
Enzymes [BR:cne01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     CNH00550
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     CNH00550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:join(1024797..1024812,1024857..1025025,1025083..1025221,1025269..1025279,1025326..1025393,1025441..1025628,1025679..1025692,1025736..1026021,1026079..1026249,1026304..1026543,1026701..1026826)
Genome map
AA seq 475 aa AA seqDB search
MPELPEVERARKLIEDSCKGYKIASVDAQEDSIIFTGGTDHNEFAKEIAGRSITGCERKG
KTFWMTLSGEGRYPVMHFGMTGMIQLKGQEPTWYRRRPKESADVWPPRFYKFVLKLEPQE
GSIADEPRELAFIDGRRLGRLRLVSDPVSSHPPVSELGFDPILNHPTLEEFTKLLVNKKG
TVKGVIMDQAFSAGVGNWVADEVLYQARIHPSCPIPALSEQNIRDLHHQLRAVPLTAISV
NADSKLFPSDWLFRWRWSKGTTQKKQMEKDKKSKGKKVVDGEGGEDVEPEDKEFLELPDG
SPATIKFIEVGGRTTALVEELQKMPEGVEIKPKISKGGKRAGAKRKKVAKEEESDEGSEL
SDQSDLEEQKPKRPLTARQKAAAEKKGINSNLASQTKTEDNKPSAAKRRAIGARTGGSKN
HPDSEVKKEKGSTECRKSKKQVEAVGEKLAKIKPQKGRKKAASTPESSELSDLVE
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgccagagctccctgaggttgaacgagctcggaaacttattgaagactcctgcaagggg
tacaagatcgcttcagtcgatgctcaagaagacagtatcatctttaccggtggaacagac
cataacgaatttgccaaagagatcgcaggaaggtctataacaggatgtgagcggaaagga
aaaacgttctggatgaccttgtcgggtgaaggacgatacccggtgatgcatttcggcatg
acaggtatgatacagctcaaaggtcaagaaccaacttggtatcggagaaggcccaaagaa
agtgcggatgtctggcctcccagattctataagttcgtactaaagcttgaacctcaagaa
ggctccatcgccgatgaacctcgagaacttgctttcatagatgggcgtcggcttggtcgt
cttcgtttggtatctgatcctgtatcttcccatcctcccgtctcggagttaggtttcgac
cctatactcaatcatccaactttggaagagtttacaaagctgctggtgaacaagaaaggt
actgtgaaaggcgtcatcatggaccaagcattcagtgcgggtgttggcaattgggttgca
gacgaggtactttaccaggcccgtatccacccttcttgccccattcccgcattatccgaa
caaaacattagagatctccaccaccaactccgtgctgtgcctctcaccgcaatatctgtc
aatgctgattcgaaactttttccttccgactggctcttccgctggaggtggagtaaaggt
acaactcagaaaaagcagatggagaaggacaaaaagagtaaagggaagaaggtcgtggac
ggtgaggggggtgaggacgtggagccggaggataaagagtttttggagcttcccgatgga
tcaccagccacgatcaaatttattgaagtcggtggacgaacgactgcactagtcgaagag
ctgcaaaagatgccggaaggagtcgagatcaagccgaaaatcagtaaaggcggcaaaagg
gccggagcgaagaggaagaaggtcgctaaggaggaagaatcggatgaagggagtgaacta
tccgaccagagtgatttagaagagcagaaacccaaaagacctctgacggcaagacaaaaa
gcagccgcagagaaaaaggggatcaacagtaatttagcctcgcagacgaaaactgaagat
aataaaccttctgctgcaaaacgacgagccattggagcaaggactggggggtccaaaaat
catccggattcggaggtgaagaaggaaaaagggagtacagaatgtcgtaaatccaagaag
caagtggaggcagttggcgaaaaacttgcaaagatcaagcctcaaaagggtagaaagaag
gcagcttcaactccagagtcttcagaactgtccgatcttgtcgaatag

DBGET integrated database retrieval system