KEGG   Cryptococcus neoformans JEC21: CNH00790Help
Entry
CNH00790          CDS       T00243                                 

Definition
Endoglucanase E-4 precursor (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cne00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:join(963790..964113,964163..964282,964333..964397,964449..965059,965104..965522,965586..965819)
Genome map
AA seq 590 aa AA seqDB search
MLIPFLALASLSRITTAQLTPSPTYSPPTSSAGLTASSETPNTQWSNILGNSLWFYDAQR
SGRLDEGTYGNRVDWRNDSALEDGSDWGLDLVGGWYDAGDYIKATFPLSFTLFALSWGAL
THGQGYGLANQTAYLDGTLRWGFDWLMKAHPSDDVLFIQVGSGDVDNNYWGGDQDIPSPR
PGYPINSSYPGTDGWAAASAAFSLGSLLYTPGVSYRPTSSSSPPTSPSLENSTYASQLLA
HAESLYSVANSTTPRQTYYAALGDEVAAYASSDWRDNLCASALALALATNNSAYYADAYN
YYVQYGLSGTHEVWNWDSSQPAIYVMFAEIASAKPELAQGAGLDVNLTGWQTEVENYFDG
LIKEDFSNSYLTEGGLLYWDGDSDEASLNPAMAAAMLMFKYAPMASSTDKTNSYNSFAQS
QLNYLLGSNPMSVPYIVGQHPNSPSNPHSAPASGGFNINNIRDDPPTEAHVLYGAVVGGP
LSSDQFWDWRDDWVQTEIALDYNAMIPTLASMQLMNNTADPPYVDIAAGTYSIPSGQPCD
AALPCRGGGGLSGGEIAGIVVGVIVGVVLLVIVGVWWWWRKRGKRWGSKW
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgctcatccccttccttgccctcgcttctctgtcccgaataaccacagcccagctcaca
ccgtctcccacttattctcctccaacctcctctgcaggactcacagcctccagcgaaaca
cccaacacacaatggtccaatatccttggtaactccctttggttctacgatgcccaaagg
tcaggtagattagatgaaggaacatatgggaacagagtagactggaggaatgatagcgct
ttagaagatgggagtgattggggtttggaccttgtcggcggatggtatgatgcgggtgac
tacatcaaggcgacatttcctttgagttttaccttatttgcgctctcctggggggcgttg
acgcatggccaaggatatggccttgccaaccaaacagcctatctcgatgggaccttgcga
tggggttttgattggcttatgaaggcacacccatcggatgatgtgctgtttatccaagtt
ggttctggggatgtcgacaacaattactggggcggggaccaggacattccaagtcctcgc
ccggggtacccaatcaactcttcttaccctggtacagatggctgggccgctgcctctgcc
gccttttcactaggttccctcctttacacaccaggcgtctcgtacagacccacttcatcg
tcctctcctccaacctcaccttcattggaaaactccacttatgcgtctcagctgttggca
cacgctgagtcgctttactctgtcgccaactctaccacccctcgacaaacttactacgcg
gctttaggtgatgaagttgccgcttacgcctcttccgactggcgagataacctctgtgca
tctgctctggctctggcactggcgacaaacaactctgcgtactacgccgatgcatacaac
tattatgtccaatatgggctgtcaggcacacatgaagtttggaactgggattcgtcacag
ccggcaatttatgtcatgtttgcggaaattgcgagcgcaaagcccgagttagcgcaagga
gctggactcgacgtgaacttgactggatggcagactgaagtcgagaactactttgatggg
cttatcaaagaggatttcagtaattcttacttgaccgaagggggattactctattgggat
ggcgactctgacgaggcgtccttgaaccctgccatggctgccgctatgctcatgttcaag
tacgcacccatggcctcttcaaccgacaagaccaactcttacaattcattcgctcaatcc
caactcaactacctgctcggctccaaccccatgtcagtcccttacatcgttgggcaacac
ccgaattccccatccaacccccactctgcccccgcttctggtggcttcaacataaataat
atccgtgacgaccctcccaccgaggcgcacgtgttatatggtgcggtggtgggtggaccg
ttgagcagtgatcaattttgggattggagagacgattgggtgcagacggagatagcattg
gattataacgcgatgattccaactctcgcctctatgcagcttatgaacaacactgccgat
ccaccttatgtcgacatcgctgcaggcacatactccatcccctctggccaaccttgtgat
gcagctcttccatgccgcggtggcggcggtcttagcggtggtgagattgcagggattgtt
gtgggtgttattgtgggtgtggtcttgttggtgattgtgggcgtttggtggtggtggagg
aagaggggaaagagatggggtagtaagtggtaa

DBGET integrated database retrieval system