KEGG   Cryptococcus neoformans JEC21: CNH00920Help
Entry
CNH00920          CDS       T00243                                 

Definition
asparagine synthase (glutamine-hydrolyzing)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CNH00920
Enzymes [BR:cne01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CNH00920
Peptidases [BR:cne01002]
 Cysteine Peptidases
  Family C44
   CNH00920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:join(923737..923905,924129..924280,924340..925165,925234..925606,925675..925933)
Genome map
AA seq 592 aa AA seqDB search
MCGIFCCFNRAGDISQYRARAIACSKRQRHRGPDWSGCYMTNNTVLVHERLAIVGVDTGA
QPLTNEDESLVLAVNGEIYNHVALRKSLKNKDAVFKTHSDCEVIMHLYKEHDTGLCNMLD
GMFSFVLVDKSVSPPRLIAARDPIGITTLYMGWNSQSPDTLYFASELKCIHEECDNLQAF
PPGHFYDSKEKKLTRYFNPSWWDSDKGVVPHNDIDYKLLRETLEAAVKKRLMSEVPYGVL
LSGGLDSSLIASIAARETDKLAEEQEKLRQERKQAIASGKWVGDEQPLASWPQLHSFAIG
LPGAPDLIAARKAADFLGTIHHEYNFTVQEGLDAIPEVIHHLETYDVTTVRASTPMYLLS
RKIKAMGVKMVLSGEGSDEIFGGYLYFHAAPTAKDFHEECVKRVKNLHTADCLRANKSTM
AWGLEARVPFLDKTFLEVSMNVDAKYKMFSKGTHQEVDEDGRPKMEKYILRKAFDCSPEG
KAYLPDSILWRQKEQFSDGVGYSWIDGMKDHAAAIVSDEKFANRATRWPLDTPDTKEAYW
IREIFEHHFPTEAAAKTAVRWVPKQEWGVSSDPSGRAVSIHTAAYADGEAKA
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtatcttctgctgcttcaaccgtgccggagacatctctcaataccgagcccga
gccatcgcctgctccaagaggcagcgacaccgtggccccgattggtcaggctgttacatg
accaacaataccgtcctcgtccacgagcgattagccattgttggtgtcgacaccggtgct
caaccccttaccaacgaagacgaaagccttgtcctcgccgttaacggtgaaatttacaac
cacgtcgctctcagaaaaagtctcaagaacaaagatgccgtgttcaagacccactcggac
tgtgaagtcatcatgcacctctacaaggagcacgacaccggtctctgcaacatgcttgac
gggatgttctcctttgtcctcgttgacaagtccgtctctcctcctcgattgatcgctgcc
cgtgatcctatcggtatcaccactctctatatgggctggaactctcagtctcccgacact
ctttactttgcttctgagctcaagtgtatccacgaggagtgcgacaacctccaggctttc
cctcccggacatttctacgattccaaggagaagaagctcactcgatacttcaacccttca
tggtgggactctgacaagggtgttgtccctcacaacgacattgactacaagcttttgaga
gaaactcttgaagctgccgtcaagaagaggttgatgtccgaagttccctatggtgtcctc
ctctcaggtggccttgactccagtttgatcgcttccatcgccgctagagaaacagacaaa
ctcgctgaggagcaagaaaaattgagacaagaacgaaaacaggctattgcgtctggcaag
tgggttggtgacgagcagccccttgcttcttggcctcaactccactcttttgccatcggt
ctccctggcgccccagatcttatcgctgcccgaaaggctgccgacttccttggtactatc
caccacgaatacaactttaccgttcaggagggtcttgatgccatccctgaagtcatccac
caccttgagacttatgatgttaccactgtccgagctagtacccctatgtaccttctcagt
aggaagatcaaagctatgggtgtgaagatggtcttgtctggtgagggtagtgacgaaatc
tttggtggttacctctacttccacgccgctcccaccgccaaagacttccacgaggaatgc
gttaagcgtgtgaagaacctccacaccgctgactgtctccgtgccaacaagtctaccatg
gcttggggtcttgaagcccgtgttcccttccttgacaagactttcctagaggtctccatg
aacgtcgatgccaagtacaagatgttctccaagggcactcaccaagaggttgacgaggat
ggtcgacccaagatggagaagtacatcttgagaaaggcgtttgactgctctcctgagggg
aaggcgtacttgcctgactctatcctctggaggcaaaaagaacaattctctgatggtgtc
ggttactcttggattgacggcatgaaggaccacgccgccgcgatcgtctccgacgaaaag
ttcgccaaccgagccacccgatggcccctcgatactcctgataccaaggaggcttattgg
atccgtgagatctttgaacaccacttccctactgaagcggctgccaagactgctgtccga
tgggtccccaagcaggaatggggtgtgtcttccgacccttccggtagggctgtgtctatc
cacactgcggcgtatgcggacggcgaggccaaggcttaa

DBGET integrated database retrieval system