KEGG   Cryptococcus neoformans JEC21: CNH01240Help
Entry
CNH01240          CDS       T00243                                 

Definition
cytochrome-b5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CNH01240
Enzymes [BR:cne01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     CNH01240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:join(826638..826691,826755..826812,826881..826912,826972..827011,827079..827172,827233..827421,827469..827535,827591..827822,827875..828167)
Genome map
AA seq 352 aa AA seqDB search
MAAARFLSSARIARPSVISRTAAQYRGYSSAAPSGGANWPLLLSVAGATGVGAYAYLQYN
PSVKKEVEAKIKGAEAEKAAAERTAAGISAFVKDTWIPFTLEKVGKYNHNTNIYHFSFGE
EGKDKISGGEVASVVLLRSPEGPEQIKDEKDKPIIRPYTPISPPDQKGSIEFMIKSYSGG
KFTPFLSNLSPGQQVLFKGPLQKFKYQPNSFEKGLCIAGGSGITPMWQLINHSLSIPEDK
TKWTLIYSNVSEADILLRKEFDALAQKYPGRLDIKYVLDKGPWGWKGETGYVTADLIKKT
FPKNEGENIRAFVCGPPGQMKAVSGEKDGMKQGELAGALKELGYTSDEVFKY
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgctaggttcctctcttctgctaggattgcccgtccttccgtcatttccagg
actgccgctcagtaccgaggctactcttctgctgctccttccggcggcgccaactggccc
ttactcttgtctgttgccggtgctaccggtgtcggtgcatacgcgtacctccagtacaac
ccttctgtcaagaaggaggtcgaggccaagatcaagggcgctgaggctgaaaaggctgct
gctgagcgtaccgctgccggtatcagcgctttcgtcaaggacacttggatcccctttacc
ctcgagaaggttggaaagtacaaccacaacactaacatctaccacttcagctttggagag
gagggtaaagacaagatctctggcggtgaggtcgccagcgtcgtccttttgaggtctcct
gagggtcccgagcaaatcaaggacgaaaaagacaagcctatcatcaggccttacaccccc
atctcgcctcctgatcagaaaggctccattgagtttatgatcaaatcgtactccggcggc
aagttcactccattccttagcaacctctcccctggtcagcaggtcctcttcaagggtccg
cttcagaagttcaagtaccagcccaacagcttcgagaagggtctctgtatcgctggtggt
tctggtattacccccatgtggcagctcattaatcactccttaagcattcccgaggacaag
accaagtggactcttatctactccaacgtctctgaggctgatatcttgttgagaaaggag
tttgacgctcttgcccaaaagtaccccggccgtcttgatatcaagtacgttctcgacaag
ggaccttggggctggaagggtgagactggttacgtcaccgccgatctcatcaagaagact
ttccccaagaacgagggcgagaatatccgtgcatttgtttgtggtcctcctggccagatg
aaggccgtgtccggtgagaaagacggtatgaagcagggtgagctcgctggcgccctcaag
gaattgggttacacttccgatgaggtcttcaagtactaa

DBGET integrated database retrieval system