KEGG   Cryptococcus neoformans JEC21: CNH02110Help
Entry
CNH02110          CDS       T00243                                 

Definition
histone deacetylation-related protein
Orthology
K11483  
histone deacetylase HOS2 [EC:3.5.1.98]
Organism
cne  Cryptococcus neoformans JEC21
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:join(535101..535196,535249..535311,535369..535526,535580..535840,535889..536738)
Genome map
AA seq 475 aa AA seqDB search
MTLTDYPTFSSSPFFYDPRNPVLPEAEQGHIRAHSNPSVAYYHPKNVGNYHYGERHPMRP
HRLELTNQLVLSYGLHEKMSYHAPRAATEEELLEFHEADYVDFLKRVTPKNAQALTKDWT
KFNVGDDCPIFYDLFSFCKQYAGGSLAAARKLSSGSADIAINWSGGLHHAKKGEASGFCY
INDIVLGILELLRYHPRVLYIDIDIHHGDGVQEAFYLSNRVLTVSFHKYAADFFPNTGNL
SEIGSDLGKYFCLNVPLQDGIDDESYISLFKAVMEPTITIFKPSAIVLQCGADSLGCDRL
GTFNLSIAAHGECVRFIKSFGLPLLALGGGGYRQSSVSRCWTYETGVLAGVQLSNELPQN
NYYEFFAPDYKLHPPLTGKIQNLNTAKSLERIRISIREKLRYLGGAPSVQMQEIPPDLQG
LLEEDEKSAAEKMDEKEEERREGKGKEIDWLDREVGGSGDGVGSGRYFGGARRRF
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgactctcacggactacccaacattctcaagtagccctttcttttacgatccccggaat
cctgtattacctgaagcagagcaaggccacattcgagcccattcaaatccatcggtcgcc
tattaccatcctaaaaatgtcggaaactaccattatggggaacgtcatcctatgcgaccg
catcgactggagttgacaaaccaactcgtactcagttatggcttacacgaaaagatgtcg
taccatgcacctcgtgcggctacagaagaggagttactggaatttcacgaagcagactat
gtcgactttctcaagcgagtcacgccaaaaaatgctcaagcactaacaaaagactggacg
aaattcaatgtcggtgacgattgccccatcttctacgatttattttctttctgcaaacag
tatgcgggtggttcactcgccgccgctagaaaactttcaagtggaagtgcggacattgct
atcaactggagcggtggattacatcacgcaaagaaaggtgaagcaagtggattctgttat
ataaacgatatcgttttgggtatccttgagcttttaagatatcatcctcgtgtgctctac
attgatatcgacattcaccacggtgatggagtgcaagaagcattttatctctccaaccgt
gttctcaccgtttccttccacaaatacgctgccgatttcttccctaacaccggtaattta
tcagaaattggctccgatctgggcaaatatttctgtctcaatgtccctttgcaagatggc
atcgacgatgaatcctacatatcactgtttaaagcggtgatggaaccaactatcactata
ttcaagccttcggcaattgtcctacagtgcggtgcggattctctaggatgcgatagattg
ggaacatttaacctctctatcgccgcccatggagaatgcgttagatttatcaaatccttt
ggacttcctctgctggctcttggtggaggcggttatcgtcagtcgtctgtgtctcgttgt
tggacatacgagactggtgttctcgccggtgtccaactatcgaacgaactcccgcagaac
aactattacgaattcttcgccccagattacaagctccatcctccgttgacaggtaaaatt
caaaacctcaatactgccaagtcgcttgaacgcatcagaatatccatccgcgaaaaactc
agatacctcggaggggctcctagcgtccaaatgcaggagattcctcccgatctacaaggg
ttactggaggaagacgaaaagtcggctgccgaaaagatggatgagaaagaagaggagagg
agggaaggaaaaggcaaggaaatagattggctggatagagaagttggtggtagtggtgat
ggggtcggttcagggaggtatttcggtggcgcgagaagaagattttag

DBGET integrated database retrieval system