KEGG   Cryptococcus neoformans JEC21: CNH02890Help
Entry
CNH02890          CDS       T00243                                 

Definition
ubiquitin carboxyl-terminal hydrolase 5 (EC:3.1.2.15)
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
cne  Cryptococcus neoformans JEC21
Brite
Enzymes [BR:cne01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CNH02890
Peptidases [BR:cne01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CNH02890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:join(304936..304938,305024..305111,305190..305331,305389..305558,305621..305813,305862..305970,306020..306344,306394..307005,307057..307389,307450..307541,307607..307789,307843..307952,308007..308169,308226..308486,308541..308858,308915..309044,309137..309246)
Genome map
AA seq 1113 aa AA seqDB search
MQQPANDVQDIILDESPAPMEVDDIPNVHDYEAYAAKCMPDLGLEIEDFQYQTWRIEHWS
QQPKRIVGPEFSCGGHKWRILLFPQGNANGQPNDMVSVYLDYANPKTAPEGWHACAQFCL
AISNPWDPTIQTSSHAHHRFVAEECDWGFTRFVDLRKLYTADPANGKNRPTIENDEVEIT
AFVRVLKDPTGVLWHNFVNYDSKKETGHVGLKNQGATCYMNSLLQSLFCTNYFRKAVYQI
PTEDDIPSESLALALQRVFYHLQTSNQPVGTTELTKSFGWKSLDSFMQHDVQEFSRILQD
KLEIKMKGTPAEGAIPKLFKGQMKNYIKCIDVDFESSVIEDFYDIQLTIKGLKDLRASFK
EYVSVETLDGENKYQAEGHGLQAARKGVIFKSFPPVLHLQLRRFEYDVEKDALVKINDRH
EFPFEIDLGEFLDESADRAQSHVYKLHGVLVHSGDLHGGHYFALIKPEKDGRWYKFDDDR
VTPVTDKEVLEDNYGGDMLNGLVPPHQRTQARTLKKFTNAYMLVYIRETELDTVLAPFTE
SDTPPHLKARLDHEREQLEAKKREKDEQHLYLTAKVITDEIFSQHQGFDLASFEDKNIPA
TDLPTFRVLKNESYPTFKSRIASHFKIPERDFRLWVLVNRQNKTTRPDVPIHENDNTQTM
ENIRNSMAARASDLKLYLDYNPDHARFNELHAEGKEPPIMIFLKWFDCSRQTLLGQGKVF
VDKYQKVSDLLGIIQERMGWPSSTPIKLYEEIKAGMIEGMKLKQSFIQNEIQDGDIICYQ
VELPEKEIADLEAQSLYSSVPQFYDFLQNRILVHFKPRYEDRAASVPEFDLMLSKKMTYD
VMAHRVGEFLKHDPLKLRFTSAHNQNGAPKAIVKRSLNQSVADITQTSYYNQHAHICIYY
ELLDISIIELETKKSLKVVWTGRHNKEEATHSFLLPKTCTFNDVADNMLKLVKLEPNGSG
KIRIFDVSPSGRSPREHTGSEMIGNLPESAELYAEEIPVEELQAGEGTKIVNVFHYSRDP
SRTHGVPCKFVLHEGEPFSETKARLQERIGVPEKEFAKYKFSLVTSTVFKQPSIVEENDI
IYDHKWAPDDALGLDHIDRRPNKANVEKGIVMR
NT seq 3342 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaacccgcaaatgatgtgcaggacattattctagacgaaagtccggctccaatg
gaagtcgatgacatcccaaatgttcatgactatgaagcgtatgccgccaagtgcatgcca
gatctaggcttagaaattgaagatttccagtaccaaacatggcgaattgagcactggagt
caacagccgaaaagaatagttggaccagagttcagttgtggtgggcacaagtggcgcatt
ttgttgtttccgcaaggaaacgcgaacggacagcccaacgacatggtctccgtctacttg
gattacgcgaacccaaagacagctcctgaaggatggcatgcgtgtgcacaattctgcctg
gccatttcgaatccatgggatcccacgattcaaacatctagccacgcgcatcatcgattt
gttgctgaagaatgtgattggggattcactcgatttgtcgacttgcgaaagttgtacaca
gcggatcctgccaacggaaagaatagaccgacgattgagaatgatgaagtggagattaca
gctttcgtgcgagtgttgaaggatcccacgggcgttttgtggcacaattttgtcaattac
gattccaagaaggagactggtcatgttggtttgaagaaccaaggcgctacgtgttacatg
aactctctcttgcaatctcttttctgtaccaattatttccgaaaagctgtctaccaaata
cccaccgaagacgacattccatccgaaagtttggctttggctcttcaacgcgtattttat
caccttcagacgtccaaccaacccgtaggaaccaccgagctcacaaaatcttttggatgg
aaatccctcgattctttcatgcaacacgacgtccaagagttcagccgtatccttcaagac
aagttggaaatcaagatgaagggaactcctgccgaaggcgccattccgaagctgttcaag
ggtcagatgaagaactacatcaagtgcatcgacgttgattttgagtcgtcagtgattgaa
gacttctatgatatccagcttaccatcaagggactgaaggatttacgagcttccttcaag
gaatatgtgtctgttgagacactcgatggcgagaacaagtatcaagcggagggacacggt
ttgcaggctgcgagaaagggcgtcattttcaaatcattccctccagttcttcatcttcag
ctgcgccgttttgaatatgacgtagagaaggatgctttggtcaagattaatgaccgtcac
gagttccccttcgagattgatttaggagaatttctcgatgagtcggccgaccgggcccag
tcccatgtctataagctccacggtgtcctcgtgcactctggtgatcttcacggcggccac
tatttcgctctcatcaaacctgaaaaggatggtcgctggtacaaatttgatgatgacaga
gttacgcccgtcacagacaaggaggtcttggaagacaattatggcggagacatgttgaac
ggtcttgtccctcctcatcagagaactcaggctagaactctcaaaaagttcaccaacgcc
tacatgttggtttatataagggaaacagagcttgacacagtgttggctccctttacagag
agtgacacacctcctcatttgaaggctcgcttggatcacgagagggagcagctcgaggct
aagaagagggagaaggatgaacagcacctgtacttgacagccaaagtcatcaccgacgaa
atcttctcccaacaccaaggtttcgatcttgcctcctttgaggacaagaatatcccagcc
accgacctgcctactttccgggtattgaagaatgagagctatccgactttcaagagcagg
attgcttcccactttaagattccagagcgcgacttccgtttgtgggtacttgtaaataga
caaaacaagacaacgcgacccgatgtccctatccacgagaatgacaacacccaaacaatg
gaaaatatccgtaattcaatggctgctcgagcttctgatctcaaattatacctcgactac
aatcctgaccatgccagatttaacgagctgcatgctgagggcaaggagccacccatcatg
atcttcctcaagtggttcgactgttctcgtcagacgctgttaggccaagggaaggtgttt
gtcgacaagtaccaaaaagtttcagacttgttgggtatcatacaggaaaggatgggttgg
ccatcttcaacgcctatcaagctctacgaggaaatcaaggcaggtatgattgagggaatg
aagttgaagcaatccttcattcaaaatgaaatccaagacggagatatcatctgttaccag
gtagaacttcccgagaaagaaattgccgatttggaagcgcaatcattgtactctagcgtt
ccacaattctacgacttcctccaaaaccgaatccttgttcacttcaagcctcgttatgaa
gacagggcggccagcgtgcccgaattcgatctcatgctgagtaagaagatgacgtatgac
gttatggcgcaccgagttggggaattcctgaaacacgaccctttgaagttgagatttacc
tcggctcataaccaaaacggtgctcctaaagctatcgtcaagcgttcgttgaatcaaagt
gtggcggatattacccagaccagctactacaaccagcatgctcacatctgcatctattac
gagttactggatatcagtatcattgagttggaaacgaaaaaatcactgaaggttgtctgg
acaggaagacacaataaagaagaagcgacacattcattcttattgcccaaaacctgcacg
ttcaatgacgtggccgataacatgttgaagctcgtcaaactcgaacctaatggcagcggc
aagattagaatcttcgatgtctcaccctctggtcgatctccacgtgaacatactggttca
gaaatgattggaaatcttcctgaatcagctgagttatatgcggaggagattcccgttgaa
gagctacaagccggcgagggcaccaagattgtgaatgtgttccactacagcagagaccct
tccaggacccatggtgttccctgcaaatttgttttgcacgagggagagcccttttctgag
accaaagcacgattgcaagagaggatcggtgttcctgaaaaggaatttgccaaatataag
ttctctttagtgacctcaacggtattcaagcaaccctccattgtggaagaaaacgacatc
atctatgatcacaagtgggcgccagatgatgctcttggtctcgaccatatcgataggcgg
ccaaacaaggcgaacgttgaaaagggtattgtaatgagatag

DBGET integrated database retrieval system