KEGG   Cryptococcus neoformans JEC21: CNH02910Help
Entry
CNH02910          CDS       T00243                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:cne01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cne00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:cne00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:complement(join(298825..299049,299121..299562,299638..299751,299816..300166,300219..300290,300349..300412,300470..300555,300610..300872))
Genome map
AA seq 538 aa AA seqDB search
MSLPQGIYLTAPIPKGGEHILSTEALEFLALLHRTFNKRRLELLKNREKVQAELDQGKPL
SFLPETREIRENLAWNCAPPGPGLEDRRVEITGPTDRKMVINALNSGAKTFMADFEDSNS
PTWSNMVLGQVNLYDAIRRQIDFEINGKAYKLSEKPAVLLVRPRGWHLPEPRLIIDGTPM
SGSLFDFGLYFFHNARELISRGSGPYFYLPKMEHHLEARLWNDAFCLATSHLGVQQGVIR
ATVLIETLPAAFQMEEILYELKEHSAGLNCGRWDYIFSFIKKQRAHKNCVFPDRSDVTMT
VPFMDAYVRLLIQTCHKRKVAAMGGMSAQIPIKNDPAANERAMSKVRADKLREVTAGHDG
TWVAHPALISIALEIFNQHMPGPNQYHIRREDVTVTDKQIADPSVPGKITEQGLRDNVSA
ALSYCAAWISGNGCVPINHLMEDAATAEIARVQLWQWCKYGSKTDSGKDINPSYVQTILS
EEASKVSKLPGIDPSHVKIASEYMAQQVKAQWPSDFLTSDLLGYLEGVGTKGGAKASL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgtctctccctcaaggcatctacctcactgctcccatccccaagggcggagagcacatc
ctctctaccgaagctctcgagtttctcgccttgctccacaggacattcaacaaacgaagg
ttggagttgttaaaaaaccgtgaaaaggtacaggccgagctggaccaaggcaagcccctc
tccttcctcccagagaccagggagattagggagaaccttgcttggaactgtgcccctccc
ggtccaggacttgaagaccgtcgagttgagatcactggcccaactgacaggaagatggtc
atcaacgctttgaactctggtgccaaaacttttatggccgactttgaggactccaattct
cctacctggtcaaacatggttctcggacaggtcaacctttacgatgctatccgacgacaa
attgactttgaaatcaatggcaaggcttacaagctctccgagaagccggctgtgcttttg
gtccgacctcgaggatggcacctccccgaaccccgtttgattatcgacggtactcccatg
tccggctccctcttcgactttggtctctactttttccacaacgcccgcgaactcatctct
cgaggttctggaccttatttctacctccccaagatggagcaccacctcgaagcgcgtctt
tggaacgatgccttctgccttgcaacaagtcatttaggtgtgcagcagggtgtaattagg
gcaactgttttaatcgagactttacctgcggcgttccaaatggaagagattttgtatgag
ttgaaggaacactctgcgggtttgaactgtgggcgatgggattatatcttcagtttcatc
aagaagcaacgtgcccacaagaactgtgtcttccctgaccgatctgacgttaccatgacc
gtccccttcatggacgcctacgtccgcctcctcatccaaacttgtcataagcgaaaggtc
gccgccatgggaggcatgtctgcccagattcctatcaagaacgatcccgctgccaatgag
cgtgccatgtccaaagttcgcgccgataagctccgtgaagtcactgcgggccatgatggc
acatgggtggctcaccccgcgctcatctccatcgcccttgagatctttaaccaacacatg
cccggtcctaaccagtaccacatccgccgcgaagacgttactgtcacagacaagcagatt
gccgacccctctgtccctgggaagattacagaacaagggttgagggataatgtgagcgcg
gctttgtcgtattgtgcggcgtggattagtgggaatggctgtgtgccgattaatcatttg
atggaggacgctgcgacggcggagattgcgagggtgcagctttggcagtggtgcaagtat
ggctccaagactgactccggcaaagacatcaatccttcttacgtccaaactattctctct
gaagaagcatccaaagtctcaaaactgcctggtattgatccatcacacgtcaagattgcg
tccgagtacatggcccagcaggtcaaggcccagtggccgagtgatttcttgacaagtgat
ttgttggggtaccttgaaggtgtcggtaccaaggggggcgccaaggctagcctttaa

DBGET integrated database retrieval system