KEGG   Cryptococcus neoformans JEC21: CNH03280Help
Entry
CNH03280          CDS       T00243                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CNH03280
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CNH03280
Enzymes [BR:cne01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     CNH03280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:complement(join(173544..173681,173761..173898,173965..174705,174799..174911,174980..175153,175224..175339,175432..175601,175686..175745))
Genome map
AA seq 549 aa AA seqDB search
MSSEKAEFDAEVKAFEAFAKSPRFARTTRPYTAADVVSKRGTLPISYPSDVQAKKLWKIL
ESKARGEGGGCTATYGALDPVQLTQMAKYLETVYVSGWQCSSTASSSLEPGPDLADYPSN
TVPNKVAQLFTAQLYHDRKQRYTRSAALANGQDPGERIDYLRPIVADADTGHGGLTAVMR
LTKMMVESGAAGIHIEDQAPGTKKCGHMAGKVLVPISEHINRLVAMRLQCDIMGTTNLVV
CRTDSEAATLLSTNIDPRDHSFILGSTNPSLPPLNDLMIAAEMEGKYGQELQKIEDAWTK
QAGLKLWPDVLADALSKHGVSSKKITEFREQSIGTSHASTLQLAQSFGLPPSATPYWSWD
TPRSREGYYRYQGGTQCAINRAIAFAPYADLLWMETKSPIYAQAKEFAEGVHKVHPGQWL
AYNLSPSFNWEKAGLGKKEMKEYVWELGKLGFVFQFITLAGLHSNAYINDLFANAFSKEG
MKAYVELIQSREREIGCDVLTHQKWSGADYADAMLMTVTGGVSSTAAMGKGVTENQFVDD
KTKDALHKL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccgagaaagcagagtttgacgccgaagtcaaagcctttgaggccttcgccaag
tccccacggttcgcacgaacaacccgcccatacaccgctgccgacgtcgtctccaaacgt
ggtactctccccatttcttacccttctgacgtccaggcgaaaaagctgtggaagatcttg
gagtcaaaagctcgtggtgagggcgggggatgtactgctacttatggcgctctcgatcca
gtgcagttgacccaaatggcgaaatatctcgagactgtatacgtatctggctggcaatgt
tcttccactgcttcatcttccctcgaacccggacccgaccttgcagactatccatccaac
accgtccccaacaaagtcgcccaactcttcacagcccaactctaccacgatcgcaaacaa
cgatacacccgctccgccgctttggccaatggccaagacccaggagagaggattgattat
ctcagacctatcgtggctgatgctgatactgggcatggtggtttgacggcagtgatgaga
ctgacaaagatgatggtcgagagtggagcagcgggaatccatatcgaggatcaagcgcct
ggtacgaagaaatgtggtcatatggctggcaaggtcctcgtccccatctccgaacatatc
aaccgcctcgtcgccatgcgtctccaatgcgacatcatgggcaccaccaacctcgtcgtc
tgccgtaccgactctgaagccgccacactcctctccactaacattgaccctcgggaccac
tcctttatcttgggttctaccaacccttccttaccccctcttaacgatctcatgatcgct
gccgagatggagggaaagtacggacaagaactccagaaaatcgaggatgcatggacgaaa
caggcgggattgaaactatggcccgacgtactcgccgacgctctctcgaagcacggcgtc
tcttccaaaaaaatcaccgagtttagagaacagtcgatcggcacctctcacgcttccact
ctccagctcgcccagtcgttcggtctccccccctcggccaccccttactggtcatgggac
accccgcgttcccgcgagggttactaccgctaccaaggcggcacccaatgcgctatcaac
cgcgccatcgcctttgcaccttatgccgacctcctctggatggagaccaagtctcccatc
tacgcgcaagcgaaagagtttgcggaaggcgtacataaagtccatccaggtcaatggttg
gcgtacaacctgagcccgagtttcaattgggaaaaggcagggttggggaagaaggagatg
aaagagtatgtgtgggagctgggaaaacttggtttcgtcttccaattcatcactctcgcc
ggcctccactcgaacgcctatatcaacgacctcttcgccaacgccttctcaaaggaaggt
atgaaggcctatgtcgagttgattcaaagtcgagaacgggagattggatgtgatgtcttg
actcatcaaaagtggtcaggcgcagactatgcagacgcaatgttgatgacggtcaccggc
ggtgtctcatccaccgctgctatgggcaaaggcgtgacggaaaaccagtttgtagatgat
aagaccaaggacgctttgcataagctctaa

DBGET integrated database retrieval system