KEGG   Cryptococcus neoformans JEC21: CNH03570Help
Entry
CNH03570          CDS       T00243                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CNH03570
Enzymes [BR:cne01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     CNH03570
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     CNH03570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:complement(join(78407..78572,78675..78815,78916..79143,79199..79270,79320..79387))
Genome map
AA seq 224 aa AA seqDB search
MTLITHAPPPPPSSEPDSPHDRSLYVYHFVFDFHIRTMKAYIYDDKPGDQRLPHDTGIDI
PEPTLAKLGVVYQRIPIDSEGAWESKIDEFAKERGYKNRDRITVTREGLGEAYEEKIKSF
FDEHLHEDEEIRYILAGSGYFDIRGAEGVHEEQWIRIALEAGDLIVLPAGIYHRFTVDSA
NTITAMRLFQDEPKWTPYSRKADGTDKLGSRDKYLETVRVGVTA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgacactgataactcacgcgcctccacctccaccctcaagtgagcctgattcgccacac
gatcgttctttgtacgtataccatttcgttttcgatttccacataagaacaatgaaggcg
tacatttacgacgacaagcctggagaccaacgtctccctcacgataccggcatcgacatc
cccgaacccaccctcgccaagctcggcgtcgtctaccagcgtatacccatcgactctgag
ggcgcgtgggaatccaagattgacgaatttgcaaaggagcgaggatacaagaacagggac
cggattactgtgactagggaagggttgggagaggcatatgaggagaagatcaagtcgttc
tttgacgagcatttgcatgaagatgaggagattcgatacatcctcgcaggatcggggtac
tttgatatccggggtgcagaaggagtgcatgaagagcaatggattaggatcgcactcgaa
gctggtgacttgatcgtccttcctgctggtatctaccaccgttttacagtcgactctgca
aacaccataacagccatgcgactcttccaagatgaacccaaatggacaccgtactcccga
aaagcggatgggacagacaagttggggagtagggataagtaccttgagacggttagagtt
ggtgttactgcttga

DBGET integrated database retrieval system