KEGG   Cryptococcus neoformans var. neoformans JEC21: CNI00240Help
Entry
CNI00240          CDS       T00243                                 

Definition
(RefSeq) enoyl-CoA hydratase
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00062  Fatty acid elongation
cne00071  Fatty acid degradation
cne00280  Valine, leucine and isoleucine degradation
cne00310  Lysine degradation
cne00380  Tryptophan metabolism
cne00410  beta-Alanine metabolism
cne00640  Propanoate metabolism
cne00650  Butanoate metabolism
cne01100  Metabolic pathways
cne01110  Biosynthesis of secondary metabolites
cne01130  Biosynthesis of antibiotics
cne01200  Carbon metabolism
cne01212  Fatty acid metabolism
Module
cne_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
cne_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CNI00240
   00650 Butanoate metabolism
    CNI00240
  Lipid metabolism
   00062 Fatty acid elongation
    CNI00240
   00071 Fatty acid degradation
    CNI00240
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CNI00240
   00310 Lysine degradation
    CNI00240
   00380 Tryptophan metabolism
    CNI00240
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CNI00240
Enzymes [BR:cne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CNI00240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 3259774
NCBI-ProteinID: XP_572730
UniProt: Q5KC50
Position
9:join(61330..61627,61695..62114,62173..62256,62315..62364)
Genome map
AA seq 283 aa AA seqDB search
MLARTLLKPSQSTYRLTIRAMSTSAEQLVIPSRSPSNNVAILTLNRPKALNALSTPLFNA
LNSELEKAETDESVRAIVITGGDKVFAAGADIKEMKDKEFAEAYTSNFLGSWNQIASIRK
PIVGAVAGYALGGGCELAMLCDILVASPTAVFGQPEITLGIIPGMGGSQRLTSLIGKARA
MDMVLTGRKIDAETAERWGLVSRVTKEGESVTEEAVKVAENVSKFGKVAVQAGKEAVNGS
LDLPLEQGLRLERRLFQQLFATKDQKEGMAAFAEKRKPTWSDK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgttagctcgcactctcctcaagccttcccaatctacataccgactcactatccgcgcc
atgtccacctctgcagaacagctcgtcatcccctctcgttctccttcgaacaacgtagcc
atcttgacccttaacaggcccaaggccctcaacgcgttgagcacacccttgttcaatgct
ctcaactccgagcttgagaaggccgagacagatgagagtgtgagggctatcgtcatcacc
ggtggtgacaaggtgtttgctgccggtgccgacattaaggagatgaaggacaaggaattt
gctgaagcatacactagcaacttccttggatcctggaaccaaatcgcctctatccgcaag
cccattgtcggtgctgtcgccggctacgccctcggaggcggatgtgagctcgccatgctc
tgcgacatcctcgtcgcttctccgaccgccgtctttggccaacccgagatcacacttggg
attattccaggtatgggcggctcccaacgccttacttccctgattggaaaggcgagggca
atggacatggtcctcactgggaggaagattgatgcggagacggctgagagatgggggttg
gttagcagggttacgaaagaaggagagagtgtgactgaggaagcggtgaaggtggcagag
aacgtgagcaagtttggaaaggtggctgtacaggctggtaaggaggccgttaatggatct
ctcgaccttcccctcgagcaaggtctaaggctcgaaaggaggctcttccagcaactcttc
gcgaccaaggaccagaaggaaggtatggctgcttttgccgagaagaggaagcctacttgg
tccgacaagtaa

DBGET integrated database retrieval system