KEGG   Cryptococcus neoformans JEC21: CNI00240Help
Entry
CNI00240          CDS       T00243                                 

Definition
enoyl-CoA hydratase
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
beta-Oxidation
Class
Metabolism; Overview; Carbon metabolism [PATH:cne01200]
Metabolism; Overview; Fatty acid metabolism [PATH:cne01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cne00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:cne00650]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:cne00062]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:cne00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:cne00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cne00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:cne00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:cne00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:join(61330..61627,61695..62114,62173..62256,62315..62364)
Genome map
AA seq 283 aa AA seqDB search
MLARTLLKPSQSTYRLTIRAMSTSAEQLVIPSRSPSNNVAILTLNRPKALNALSTPLFNA
LNSELEKAETDESVRAIVITGGDKVFAAGADIKEMKDKEFAEAYTSNFLGSWNQIASIRK
PIVGAVAGYALGGGCELAMLCDILVASPTAVFGQPEITLGIIPGMGGSQRLTSLIGKARA
MDMVLTGRKIDAETAERWGLVSRVTKEGESVTEEAVKVAENVSKFGKVAVQAGKEAVNGS
LDLPLEQGLRLERRLFQQLFATKDQKEGMAAFAEKRKPTWSDK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgttagctcgcactctcctcaagccttcccaatctacataccgactcactatccgcgcc
atgtccacctctgcagaacagctcgtcatcccctctcgttctccttcgaacaacgtagcc
atcttgacccttaacaggcccaaggccctcaacgcgttgagcacacccttgttcaatgct
ctcaactccgagcttgagaaggccgagacagatgagagtgtgagggctatcgtcatcacc
ggtggtgacaaggtgtttgctgccggtgccgacattaaggagatgaaggacaaggaattt
gctgaagcatacactagcaacttccttggatcctggaaccaaatcgcctctatccgcaag
cccattgtcggtgctgtcgccggctacgccctcggaggcggatgtgagctcgccatgctc
tgcgacatcctcgtcgcttctccgaccgccgtctttggccaacccgagatcacacttggg
attattccaggtatgggcggctcccaacgccttacttccctgattggaaaggcgagggca
atggacatggtcctcactgggaggaagattgatgcggagacggctgagagatgggggttg
gttagcagggttacgaaagaaggagagagtgtgactgaggaagcggtgaaggtggcagag
aacgtgagcaagtttggaaaggtggctgtacaggctggtaaggaggccgttaatggatct
ctcgaccttcccctcgagcaaggtctaaggctcgaaaggaggctcttccagcaactcttc
gcgaccaaggaccagaaggaaggtatggctgcttttgccgagaagaggaagcctacttgg
tccgacaagtaa

DBGET integrated database retrieval system