KEGG   Cryptococcus neoformans JEC21: CNI00240Help
Entry
CNI00240          CDS       T00243                                 

Definition
enoyl-CoA hydratase
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CNI00240
   01212 Fatty acid metabolism
    CNI00240
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CNI00240
   00650 Butanoate metabolism
    CNI00240
  Lipid metabolism
   00062 Fatty acid elongation
    CNI00240
   00071 Fatty acid degradation
    CNI00240
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CNI00240
   00310 Lysine degradation
    CNI00240
   00380 Tryptophan metabolism
    CNI00240
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CNI00240
Enzymes [BR:cne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CNI00240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:join(61330..61627,61695..62114,62173..62256,62315..62364)
Genome map
AA seq 283 aa AA seqDB search
MLARTLLKPSQSTYRLTIRAMSTSAEQLVIPSRSPSNNVAILTLNRPKALNALSTPLFNA
LNSELEKAETDESVRAIVITGGDKVFAAGADIKEMKDKEFAEAYTSNFLGSWNQIASIRK
PIVGAVAGYALGGGCELAMLCDILVASPTAVFGQPEITLGIIPGMGGSQRLTSLIGKARA
MDMVLTGRKIDAETAERWGLVSRVTKEGESVTEEAVKVAENVSKFGKVAVQAGKEAVNGS
LDLPLEQGLRLERRLFQQLFATKDQKEGMAAFAEKRKPTWSDK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgttagctcgcactctcctcaagccttcccaatctacataccgactcactatccgcgcc
atgtccacctctgcagaacagctcgtcatcccctctcgttctccttcgaacaacgtagcc
atcttgacccttaacaggcccaaggccctcaacgcgttgagcacacccttgttcaatgct
ctcaactccgagcttgagaaggccgagacagatgagagtgtgagggctatcgtcatcacc
ggtggtgacaaggtgtttgctgccggtgccgacattaaggagatgaaggacaaggaattt
gctgaagcatacactagcaacttccttggatcctggaaccaaatcgcctctatccgcaag
cccattgtcggtgctgtcgccggctacgccctcggaggcggatgtgagctcgccatgctc
tgcgacatcctcgtcgcttctccgaccgccgtctttggccaacccgagatcacacttggg
attattccaggtatgggcggctcccaacgccttacttccctgattggaaaggcgagggca
atggacatggtcctcactgggaggaagattgatgcggagacggctgagagatgggggttg
gttagcagggttacgaaagaaggagagagtgtgactgaggaagcggtgaaggtggcagag
aacgtgagcaagtttggaaaggtggctgtacaggctggtaaggaggccgttaatggatct
ctcgaccttcccctcgagcaaggtctaaggctcgaaaggaggctcttccagcaactcttc
gcgaccaaggaccagaaggaaggtatggctgcttttgccgagaagaggaagcctacttgg
tccgacaagtaa

DBGET integrated database retrieval system