KEGG   Cryptococcus neoformans JEC21: CNI00410Help
Entry
CNI00410          CDS       T00243                                 

Definition
MAP kinase
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:cne00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    CNI00410
Enzymes [BR:cne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CNI00410
Protein kinases [BR:cne01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   CNI00410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:complement(join(100572..100722,100798..100968,101027..101402,101480..101639,101700..101771,101821..101920,101983..101990,102085..102280,102342..102388))
Genome map
AA seq 426 aa AA seqDB search
MDNTPRHLFQTPNNVYILQQPWQFVKELGQGAYGCVSSARNSSTGETCAVKKVTNVFQKK
ILTKRCLRELRLLHHFRGHKNITCLYDMDIVFDPPGSGQFREVYLYEELMEADLHAIIRS
GQPLSDAHFQSFLYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFQPG
AVQTDQGQAGFMTEYVATRWYRAPEIMLSFANYTSSIDMWSVGCILAELLGGKPIFKGED
YVDQLNKILNLLGTPTEDTLRRVGSPRAQDYIRSLPIKPRVKFETLYPNASPLALDLLSK
LLTFDPAKRYGCEEALEHQYLAVWHDPADEPLCEVPFDFSFEEEDSVSGMRDLILEEVRS
FRYLVRQQSMPPARKDSHELPPAPPAPQHPGAGVGPAFHERANSEGDMEEHPGSALEKQL
ERQKLS
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggacaacactcctcggcaccttttccagacacccaacaacgtctacatccttcagcag
ccatggcagtttgtcaaggaactcgggcaaggggcgtacggttgcgtgtcttctgcgagg
aactctagtacgggagaaacatgcgcggtgaaaaaggtaacgaatgtgtttcaaaagaag
atcttgacaaagcggtgtctgagagagttgaggttgttacatcacttcagagggcataaa
aatatcacctgcttgtacgacatggacattgtctttgaccctcctggatcaggacaattc
cgtgaagtctacttgtacgaagagctcatggaggctgatttacatgccattattcgatct
ggacaacctctttccgatgcgcacttccaatcattcttatatcaaactctctgtggtctc
aagtacattcactctgccaacgtcctccaccgagatctgaaacctggaaaccttctcgtg
aatgccgattgcgagctcaagatttgtgatttcggtttagctcgtggtttccagcctgga
gcggtgcagacggatcaaggtcaagccgggttcatgactgaatatgtcgccacaagatgg
tatcgagcccccgaaattatgctttcatttgcgaattacacttcaagcatcgatatgtgg
tctgttggatgtatcctcgccgaacttcttggcggtaaacccattttcaagggtgaagat
tacgtcgatcagctgaacaagatcctcaaccttctcggtacccccactgaagacactctc
cggagagttggttcgccaagagctcaggattacatcaggagcctgcccatcaagccgcgc
gtcaagtttgagacattgtatcctaacgcatctcccttggcgttggatttgttgagcaaa
ctgttaacatttgaccccgccaagagatatggctgcgaagaagccctagaacaccagtat
cttgcggtatggcacgatcccgccgacgaacccctttgcgaagtcccgtttgacttttcc
tttgaagaagaagattccgtcagcgggatgagggatttgatcctcgaagaggtcaggagt
ttccgatacctcgtgaggcaacaatctatgcctcccgccaggaaagactctcatgagctt
cccccggctcctcctgcacctcaacatcccggtgccggcgttggtcccgccttccacgaa
agagcgaacagcgaaggcgatatggaggaacaccctgggtccgcattggagaaacagttg
gagaggcagaaattatcatag

DBGET integrated database retrieval system