KEGG   Cryptococcus neoformans var. neoformans JEC21: CNI00560Help
Entry
CNI00560          CDS       T00243                                 

Definition
(RefSeq) anthranilate synthase
  KO
K13501  anthranilate synthase / indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.3.27 4.1.1.48 5.3.1.24]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cne01100  Metabolic pathways
cne01110  Biosynthesis of secondary metabolites
cne01130  Biosynthesis of antibiotics
cne01230  Biosynthesis of amino acids
Module
cne_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CNI00560
Enzymes [BR:cne01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CNI00560
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     CNI00560
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     CNI00560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI GATase Peptidase_C26 His_biosynth FMN_dh QRPTase_C YjeF_N
Motif
Other DBs
NCBI-GeneID: 3259660
NCBI-ProteinID: XP_572795
UniProt: P0CN86
Position
9:join(133178..133303,133356..133526,133572..135533)
Genome map
AA seq 752 aa AA seqDB search
MGFTLLIDNYDSFTWNIYADLASVGGNPYVVRNDKITLKEIEGMFSDGELERIVISPGPG
HPRTDSGVSRDVIAWGMGKLPILGVCMGLECIVDLLGGEIAYAGEIKHGKTSLVQHDSIG
VFHNLPQFLSSTRYHSLSAQIQSLPSVLQVTSTTKESGVIMGVRHRTYTVEAVQYHPESC
MSEGGRGLMANFIQMKGGKWGGENAWCGVPAEGEEEQPKAKTNGAPSLPTILNRIHAQRL
LDVEQAEKVPATSPANVSTSLSLYASPPLINFRDRMVSTPHTAVMAEIKRASPSKGDIAP
TASAPEQALKYALAGASVISVLTEPTWFKGSLLDMLAVRNAVDSLPNRPAILRKDFVLSK
YMIDEARLYGADTVLLIVAMLEPQQLKELYDYSVSLGMEPLVEVNNPTELSLALEIGSKV
IGVNNRNLHDFNVDMSTTSRVNAALNGRDVVLCALSGISSHEDVEKYVKEGVKGVLVGEA
LMRASDTKAFLRSLIGLPPLEVVPKSRPLVKICGIRSTDDAKLAISAGADLLGVILVPGT
KRCISTSTAREISALVQSARSQSSSKPLEPSLSSPWFTTQSDLLSSRRKPLLVGVFQNQS
LSDILSAVEEIGLDLVQLHGDEPQAWAKFIPVPVVKVFRVSPEGIVRGGEFRRPGLNQAI
LLDAGGVSGGGGEGKAFPWEHAKRLIQSGEVGSEGHMPLPVILAGGLTPENVGQAIEQAG
EGVWCVDVSSGVEGEGGKVKEKVEAFVKAVRG
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgggctttactctccttatcgacaactatgactctttcacttggaacatttacgccgat
ctcgcttctgtcggcggtaacccctatgtcgtccgtaatgataagattacccttaaggag
atcgaggggatgttttctgatggcgagcttgagcggatcgtcatatctcccggtcctggg
catcctaggacagactctggtgtctctagggacgtgatcgcttggggaatgggcaagttg
cctattttgggtgtgtgcatgggtctggagtgtattgttgacctgctcggtggagagatc
gcttatgccggtgaaattaagcatggtaaaacctcgcttgtccagcatgactctatcggg
gtcttccataacctcccccagtttctctcttctactcgataccattccctttccgcccaa
atccagtcgcttccttcagtcttgcaagtcacttcgactaccaaagaatctggtgtgatc
atgggtgtacgacacaggacctacaccgttgaagccgtgcagtatcatcctgagagttgc
atgagtgaaggcggtcgaggcttaatggccaatttcatccaaatgaagggcggcaaatgg
ggtggcgaaaatgcttggtgtggcgttcccgcggagggcgaggaggagcagcccaaggcg
aagaccaatggtgctccaagcttgcctactattttgaataggattcacgcgcagaggtta
ttggacgttgagcaagccgaaaaggttcctgctacaagccctgccaacgtctctacctct
ctttccctctacgcttctccacctctgatcaactttagggaccgtatggtctctactccc
cacactgccgtcatggctgagattaagcgtgcttctccctccaagggcgatatcgctcct
accgcttccgctcctgagcaagcactcaagtatgctcttgccggggcttccgtcatctcg
gttctcacagagcctacgtggttcaagggcagcttgcttgacatgctcgctgtgcgcaac
gctgttgatagtcttcccaaccgtcctgccatcttgcgaaaggattttgttttgtccaaa
tacatgattgatgaggctagattatatggcgccgacactgtgcttctcattgtcgccatg
ctcgagcctcagcaacttaaggaattgtacgattactctgtctctcttggcatggaaccc
ctcgtcgaggtcaacaaccctaccgagctctcactcgcccttgaaattggttccaaggtc
attggtgttaacaaccgtaatctacatgactttaatgttgacatgtccaccacttctcga
gtcaacgccgctctcaacggacgggacgttgttctttgcgctttgagcggtatttcgagt
cacgaggatgttgagaagtatgtcaaagaaggtgtcaagggtgtgcttgttggtgaggct
ttgatgcgagcaagcgacactaaggctttcctccggtcgcttattggcttaccgccttta
gaagtcgttcctaagtccaggccgctcgtcaagatttgcggtatccgttctacagatgac
gctaagcttgcaattagtgccggtgccgatctccttggtgtaatccttgtccccggtacg
aaacgttgcatatccacttctaccgcccgcgaaatttctgctcttgtgcaatccgcccga
tctcaatcctcttccaagccattagaaccttctctttcctccccttggtttaccacccaa
tccgacctcctctcatcccggcgcaaacccctactagtcggtgtcttccaaaatcagtct
ctctccgacatcctctcagccgtggaggagattggcctcgaccttgttcaactacacggt
gatgaaccccaagcctgggccaagttcatccccgtgcctgtggtcaaggtgttccgagtt
tcgcctgaaggaatagttagaggtggtgagttcaggcggccaggtttgaaccaagcaatc
ttgctcgatgctggtggtgtgtctggcggtggtggggaaggaaaagccttcccttgggaa
catgccaagcggctcatccaatccggcgaggtggggtctgaaggtcatatgcctctccct
gtcatcctcgctggtgggttgacgcctgagaatgtgggccaggcaattgaacaagctggt
gaaggcgtttggtgtgtggacgtcagcagtggggtcgaaggagaaggaggaaaggtcaag
gagaaggttgaggcgtttgtgaaggccgtaaggggttga

DBGET integrated database retrieval system