KEGG   Cryptococcus neoformans JEC21: CNI00560Help
Entry
CNI00560          CDS       T00243                                 

Definition
anthranilate synthase
Orthology
K13501  
anthranilate synthase / indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.3.27 4.1.1.48 5.3.1.24]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CNI00560
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CNI00560
Enzymes [BR:cne01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CNI00560
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     CNI00560
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     CNI00560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:join(133178..133303,133356..133526,133572..135533)
Genome map
AA seq 752 aa AA seqDB search
MGFTLLIDNYDSFTWNIYADLASVGGNPYVVRNDKITLKEIEGMFSDGELERIVISPGPG
HPRTDSGVSRDVIAWGMGKLPILGVCMGLECIVDLLGGEIAYAGEIKHGKTSLVQHDSIG
VFHNLPQFLSSTRYHSLSAQIQSLPSVLQVTSTTKESGVIMGVRHRTYTVEAVQYHPESC
MSEGGRGLMANFIQMKGGKWGGENAWCGVPAEGEEEQPKAKTNGAPSLPTILNRIHAQRL
LDVEQAEKVPATSPANVSTSLSLYASPPLINFRDRMVSTPHTAVMAEIKRASPSKGDIAP
TASAPEQALKYALAGASVISVLTEPTWFKGSLLDMLAVRNAVDSLPNRPAILRKDFVLSK
YMIDEARLYGADTVLLIVAMLEPQQLKELYDYSVSLGMEPLVEVNNPTELSLALEIGSKV
IGVNNRNLHDFNVDMSTTSRVNAALNGRDVVLCALSGISSHEDVEKYVKEGVKGVLVGEA
LMRASDTKAFLRSLIGLPPLEVVPKSRPLVKICGIRSTDDAKLAISAGADLLGVILVPGT
KRCISTSTAREISALVQSARSQSSSKPLEPSLSSPWFTTQSDLLSSRRKPLLVGVFQNQS
LSDILSAVEEIGLDLVQLHGDEPQAWAKFIPVPVVKVFRVSPEGIVRGGEFRRPGLNQAI
LLDAGGVSGGGGEGKAFPWEHAKRLIQSGEVGSEGHMPLPVILAGGLTPENVGQAIEQAG
EGVWCVDVSSGVEGEGGKVKEKVEAFVKAVRG
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgggctttactctccttatcgacaactatgactctttcacttggaacatttacgccgat
ctcgcttctgtcggcggtaacccctatgtcgtccgtaatgataagattacccttaaggag
atcgaggggatgttttctgatggcgagcttgagcggatcgtcatatctcccggtcctggg
catcctaggacagactctggtgtctctagggacgtgatcgcttggggaatgggcaagttg
cctattttgggtgtgtgcatgggtctggagtgtattgttgacctgctcggtggagagatc
gcttatgccggtgaaattaagcatggtaaaacctcgcttgtccagcatgactctatcggg
gtcttccataacctcccccagtttctctcttctactcgataccattccctttccgcccaa
atccagtcgcttccttcagtcttgcaagtcacttcgactaccaaagaatctggtgtgatc
atgggtgtacgacacaggacctacaccgttgaagccgtgcagtatcatcctgagagttgc
atgagtgaaggcggtcgaggcttaatggccaatttcatccaaatgaagggcggcaaatgg
ggtggcgaaaatgcttggtgtggcgttcccgcggagggcgaggaggagcagcccaaggcg
aagaccaatggtgctccaagcttgcctactattttgaataggattcacgcgcagaggtta
ttggacgttgagcaagccgaaaaggttcctgctacaagccctgccaacgtctctacctct
ctttccctctacgcttctccacctctgatcaactttagggaccgtatggtctctactccc
cacactgccgtcatggctgagattaagcgtgcttctccctccaagggcgatatcgctcct
accgcttccgctcctgagcaagcactcaagtatgctcttgccggggcttccgtcatctcg
gttctcacagagcctacgtggttcaagggcagcttgcttgacatgctcgctgtgcgcaac
gctgttgatagtcttcccaaccgtcctgccatcttgcgaaaggattttgttttgtccaaa
tacatgattgatgaggctagattatatggcgccgacactgtgcttctcattgtcgccatg
ctcgagcctcagcaacttaaggaattgtacgattactctgtctctcttggcatggaaccc
ctcgtcgaggtcaacaaccctaccgagctctcactcgcccttgaaattggttccaaggtc
attggtgttaacaaccgtaatctacatgactttaatgttgacatgtccaccacttctcga
gtcaacgccgctctcaacggacgggacgttgttctttgcgctttgagcggtatttcgagt
cacgaggatgttgagaagtatgtcaaagaaggtgtcaagggtgtgcttgttggtgaggct
ttgatgcgagcaagcgacactaaggctttcctccggtcgcttattggcttaccgccttta
gaagtcgttcctaagtccaggccgctcgtcaagatttgcggtatccgttctacagatgac
gctaagcttgcaattagtgccggtgccgatctccttggtgtaatccttgtccccggtacg
aaacgttgcatatccacttctaccgcccgcgaaatttctgctcttgtgcaatccgcccga
tctcaatcctcttccaagccattagaaccttctctttcctccccttggtttaccacccaa
tccgacctcctctcatcccggcgcaaacccctactagtcggtgtcttccaaaatcagtct
ctctccgacatcctctcagccgtggaggagattggcctcgaccttgttcaactacacggt
gatgaaccccaagcctgggccaagttcatccccgtgcctgtggtcaaggtgttccgagtt
tcgcctgaaggaatagttagaggtggtgagttcaggcggccaggtttgaaccaagcaatc
ttgctcgatgctggtggtgtgtctggcggtggtggggaaggaaaagccttcccttgggaa
catgccaagcggctcatccaatccggcgaggtggggtctgaaggtcatatgcctctccct
gtcatcctcgctggtgggttgacgcctgagaatgtgggccaggcaattgaacaagctggt
gaaggcgtttggtgtgtggacgtcagcagtggggtcgaaggagaaggaggaaaggtcaag
gagaaggttgaggcgtttgtgaaggccgtaaggggttga

DBGET integrated database retrieval system