KEGG   Cryptococcus neoformans JEC21: CNI00640Help
Entry
CNI00640          CDS       T00243                                 

Definition
hypothetical protein
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.1.2.15]
Organism
cne  Cryptococcus neoformans JEC21
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:join(152902..153183,153225..153332,153387..153461,153521..153648,153700..153845,153898..154217,154269..154610,154698..155557,155641..155754,155819..156389,156596..156967,157053..157161,157218..157420)
Genome map
AA seq 1209 aa AA seqDB search
MVKALPKPCQDWDWVGTEVRTPGQITLEHRRRAAGLVTSVVCPRDLTHLGRETTKDDSEV
KGNGKGTGEKKGTGCRAKNCKSNYMCYNNLGTEKLLEPDAKAEFVISNLGDVPQERNGPA
GLRNLGATCYANAFLQLWFHNVPFRNAVYACVTTETTPLYQLALIFAKLEYGEKNVVDPM
GLIDALRLNMGDQQDAAEFSKLFMSLIASEFSKHSDPKLKTLVKDQFEGTMQYITQCECG
YESISETTFLEIELSLKDNTTLQSRLDEFTCPEILDGDNKYSCPSCLSKRRATRRQLPVT
LPPVIHFSLLRFVFDLKSMSRKKSKASIKYPKEAVLGNSVYELKGIISHQGTSAYHGHFV
CETYDESNDTWYICNDELVQPKPVRPHKKIKLEKPGDDKGKLESSKDAYMLVYKRRDGHV
SPQFPPAIVMEKVKEENRGLREELNKVGVRKEVLEDEWEHLKGAKVDTDYIVPRDALAKW
IQSPSFQDLYKPFDYSSILCAHSQVDPLKSSDIRTISALAHDKLLLYTSLPEIDVCLICV
AEGFVARSSITEQQSALEAFDELNAKAELEEGGEEERWCLPKTWLIHWRTGKLPPQTLPT
HSSYTLLCPHNAPLPSSSAPPVTFITSSALSLLHSIFGSFPSFQPGTPPCPECSFEADQN
AESLAQWKTDVKLDKSIKRHLDPRPPAFGLDYYVLPKEFIEKWEVYMKTPAGEKPELDMG
LGRGRCEHGLLDWDPQMEKQRVISEIGWEMLCQKYGEKEPIKVQFGANPPEGKKVNIASF
TPAVCEPCRIIRLSSYDELEIPIVFAPGPPTSYSTPASTGNTSGSKSGSGSSRNTSRTLR
SRLKTLYIQATRQSTIKDLKVSILSQTGITPLLQKIYYKRRTQPQEQEECSGKGNEEEKE
LDNDLTIGKLGYLKGEELILVEVKEEGNLDDDDDTVDGGNGGKGKNGKNEGFGGTALLAR
IACPDCTYENDGAAECCEMCMRDMYDSIRTCSLYTPGSDYAQEENRRVTILDLASNSIEC
SALQAWVGTTGGMTEEDGESGWEEWIVAFKDAAMSLEWTMKEFRSLYRLQFNNLVYFQSQ
ATQHRRHLMGTDLYPSDKNMADFYRTLEVSKYLEAKKEQPAPTRAKAHNPVTPQTQPTPG
SPSGKHIREIFTNKNRCNDCSQVGHNYKTCPKRLYSPGIIRPIKIVQILVTHLQRHHPFT
STSLSASSF
NT seq 3630 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaagccttgccaaaaccctgccaggactgggactgggtcggtacagaggtccga
acgccaggtcagatcacgctcgaacatcgacggcgtgcagctgggcttgttacaagcgtc
gtttgtcctcgcgacctcacacaccttggaagagagactaccaaggatgatagtgaggta
aaagggaatggaaaaggaactggggagaagaagggcacaggatgtagagcaaaaaattgc
aaatcgaattacatgtgttacaataaccttggaacggaaaagcttttggaacctgatgcg
aaagcagaattcgttatttcaaacctaggagatgttccacaagagcgtaatgggcccgct
ggtttaagaaacctcggggcgacgtgctatgcaaacgccttcttgcaattgtggttccac
aacgtgccttttcgtaatgcagtctatgcttgcgtgactacagagaccacaccactctac
caattagctctcatcttcgctaagctggaatatggcgaaaagaatgtagtggatcccatg
ggtctgatagacgctctgcgactcaatatgggtgatcaacaagatgcagccgagttctca
aaactgttcatgtcattgatcgcatcagaattctcaaaacattccgaccctaaactcaaa
acgttggttaaagatcagtttgaagggacaatgcagtatattacccagtgtgaatgtggg
tacgaaagtatctctgagaccactttcctcgagattgaactctcgctgaaagacaataca
acccttcaatcccgcctggacgaattcacatgccctgaaatccttgatggggacaacaaa
tactcttgcccctcctgcctctctaaacgccgtgcaacccgtcgtcagctgcccgtcacc
ctccctcccgttatccacttctctcttctcaggtttgtcttcgatctcaaaagcatgtcg
agaaagaagagtaaagcgtcgataaagtatccgaaagaggcggtgcttgggaattcggta
tatgaattaaaaggaattatatctcatcaagggacaagcgcgtatcatggtcatttcgtt
tgcgagacatatgatgaaagcaatgatacctggtatatctgtaacgacgagttggtgcag
cctaaacctgtccggccgcacaagaaaatcaagcttgagaaacctggcgatgacaagggc
aagttagaatcatccaaagatgcctacatgctcgtctacaaacggcgagatggccatgtg
tctccccaatttccaccagcgattgtcatggagaaggttaaggaggagaatagagggttg
agggaagaattaaataaagtgggggtgaggaaggaagttttggaagatgagtgggagcat
ctaaagggggcgaaggtggatacagactacattgttcctcgcgacgccctcgccaaatgg
atccagtctccctcctttcaagatctctacaagccattcgactactcatccatcctctgt
gctcattcgcaagtggatcccctcaaatcttctgatatacgtacaatatccgcgctagct
catgataaacttttgttatatacttctcttcccgagatcgacgtctgcctaatatgtgtt
gcggaaggttttgtcgcaaggtcgagtataacggagcagcagtcggcgcttgaggcattc
gacgaactcaatgccaaggccgagttggaagaagggggtgaagaagaacggtggtgtctt
cccaaaacgtggctcatccactggcgaacaggcaaacttcctcctcaaaccttgcccaca
cactcttcctacaccctcttatgcccccacaacgcccccttaccttcatcttccgccccg
cccgtcaccttcataacctcctctgccctttccctcctccactccatctttggctccttc
ccttcgttccaacccggaacacccccctgccccgagtgttccttcgaggcagaccaaaat
gcagaatcgttggcacaatggaaaacggatgtgaagcttgataaatctatcaaacggcac
cttgacccgcggccgcctgcttttggattagattattatgtacttccaaaagagtttatt
gagaaatgggaggtgtatatgaagactccagcgggggagaagccagagttggatatgggt
ctgggacgagggagatgtgagcatggattgttggactgggatccgcagatggagaaacag
agggtgattagtgagatcggatgggagatgctttgtcagaagtacggtgagaaagagcca
attaaagtacaatttggtgccaaccccccggaaggaaagaaagtgaacattgcttctttc
actcctgctgtctgcgagccatgcaggattatcagattatcatcatacgacgaactcgag
ataccaatcgtcttcgctcctgggccgcccacatcttacagcacccccgcctctacaggc
aataccagcgggtcaaagtcaggatcaggatcaagccgtaacacatcaaggaccctacgg
tcccggcttaaaacgctatacatccaggccacgagacaaagtacaatcaaggatctcaaa
gtatccattctttctcaaacaggaatcaccccgcttctccagaagatttattacaaacgt
cgaacccaaccccaagagcaagaggaatgttcggggaaagggaatgaagaagaaaaagag
ctagataatgatttgacgattggcaagctgggatatttgaaaggggaggagttgatattg
gttgaagtgaaagaagaagggaatctggatgatgatgatgacactgtagatggaggtaat
ggaggcaagggaaaaaatggaaagaatgaaggattcggagggacggcattgttggcgagg
attgcatgtccggattgtacttatgaaaatgatggggcagcggaatgctgtgagatgtgc
atgagagatatgtatgacagtattcggacttgctctctttatacccccggaagcgattac
gcgcaggaagagaatcggcgagtaaccatcctggatctggcgagtaactccatcgaatgt
tcggccctgcaagcatgggtggggactactggtgggatgacggaagaggatggcgagtca
ggatgggaggaatggattgtggctttcaaggatgctgcgatgtcgttagaatggacgatg
aaagaatttcgttcactttaccgtctgcaattcaacaacttggtctactttcaatcacaa
gctacccaacatcgccgccatttgatgggtaccgacctctatcccagcgacaagaatatg
gccgatttctatcgcactttagaagttagcaagtacttggaggcgaaaaaggagcagcct
gcacccactcgtgccaaggctcacaatccggtgaccccacagacccaacccacacctggc
tcaccctctggtaaacacattcgcgaaatcttcaccaataagaaccggtgcaacgactgc
agccaagttggtcacaactacaaaacctgtccaaagcgactctactcgcccggtatcatc
cgtccgataaaaatcgtccaaatcctcgttactcaccttcaacgccatcacccctttaca
tccacttctctttctgcatcttctttttag

DBGET integrated database retrieval system