KEGG   Cryptococcus neoformans JEC21: CNI01240Help
Entry
CNI01240          CDS       T00243                                 

Definition
protein kinase
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
cne  Cryptococcus neoformans JEC21
Brite
Enzymes [BR:cne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CNI01240
Protein kinases [BR:cne01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   CNI01240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:join(304017..304292,304382..304496,304547..304655,304752..304916,305095..305687,305832..306634,306708..307931,307965..308087,308148..308454,308509..308599,308668..308810,308866..309362,309423..309446)
Genome map
AA seq 1489 aa AA seqDB search
MSSSPRGRRAPAPAALDLGPRTDGSRYGAVGLGLGAGHEADGRRVFTEPVSFPAVAIADV
AVAAHVQAAAASARPRSVFQRPALAARRQPQLLPGSAQPHPSSIDRRTLVGVGELSTPRW
PGSGVHNRAPNAHNGPARGPFDGTSEAYLGDTVASPSARHKIASHTAITSRLSCDIDVSK
DGLAKDELVGLVKDGLAKDGLAKEPSLTPTRIHTPSFAGECSKTPPNPSRHNPSHDILKQ
FAVKDFSHLPPSPSSASINQFLRASGSTQNISSGTPPGSASASNAYFPSKGVQREDSQKS
QKSQKQQRTTPKPKELDPNVDEALRKLDGLTGTPGKNKAKGKSSGGPSAASSRPGTPVAE
SKSRSEGKIPSKPSIGSFKDATGSPLSNWIDLTEDLPAIPIPRARIPPNRESSSSASVTD
QPEETEKSVPPVPPLPQVYVNKKQSMPAQSSAMRPPSYVPMREPSPEPPAVSSPFEPGSP
STTAPVPVPAQPKMHKKWSFSSALNLKSAASSASSVDEMRMTTPQSPQTPWSEIHRAELF
SPSSSVHGKESAGGDSGPQGATPLAPPSSKASNVNKRLTPSSIPFFRRSSSSSFQSKASQ
SVAPLPVPLPETPKQTEKTAAVPSSQSRKSVLGMHFPSMLRGSSSKRGLAQQTSQSQVSA
KGKEEVKPTSAPSASATSGWTGRKRGKTLSISGDLPNPFPGLKHQSSADSSFGTRGSAVS
SNSDATTISGSNTFDRLPAIMGSPARPPEGARYSNSPRNLPSTTPTKIPRMTQRPAPSPA
TVTAHSGMPPPPFPTTRKISNTVSGAGEQQQRGGPPVSEFGMVDGIPHMPTTPRLTTSGA
HRAHLLAPMSARQETRRVNNRPFDPPPRSKEAYTGAVPPSRRHLPQPPPASTVTSMTLSA
SAKRASREFKNKRRESKDGQDGSSSGKNSPVKPSKSMHSSMAVPSSSRLPSSYSAGTPGS
NYRKLSLADSSPSMSPADDDEASGDAEMEAYIKRRRERAAANKKDDLSDVTEFPRDITPV
EPLSQRAFITRNLAKMSDAERKEVLDFDYIYYSPTPGTIRRPSQPGGAMFNHGYDDERGD
YLVVEGDHLCYRYEVVVQCRDHKTGKSVAVKIIRNKKRFHTQALVEVKILQQLIEWDPED
KHFMVRMTDSFSFRNHLCIVTELLSINLYELIKANHFAGFSTVLIRRFTTQMLGSLQLMR
SHRIVHCDLKPENILLCHPSKSAIKVIDFGSSCLETEKVYTYIQSRFYRSPEVILGMNYA
MAIDMWSLGCILAELYTGVPIFPGENEHEQLACIMEVLGVPDRYLIEKASRRKNFFDATG
APRPFVNAKGRRRRPGSKTLAGVLKCDDELFVDFIARCLTWDPDKRLKPQPAMRHPWILA
GRRRYAPTPSRDEKRATTTERSSRLFGTSHTSTRISSKNLSELSTSSMKDKDKSKLLISS
PVPLAPAKHPYHASTASTSRIGQAMSSSRLAHQTSARSGSLTTSKLSIG
NT seq 4470 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgtcgccgcgcggccggagagcgcccgcccccgccgcgctcgaccttggccca
cgcacagacgggagcaggtacggcgctgtcgggctcggcctcggcgcaggccacgaagct
gacggccgacgggtgttcaccgagcctgtgagttttcccgccgtcgccatcgctgacgtc
gcagtcgcagcgcatgtccaggccgctgccgcatccgccaggccacgaagcgtcttccag
cggcccgcacttgccgcgcgacgccagccgcaactcctgcccggctccgcccagccccac
ccttcgagcatcgaccgccgcaccttggtgggcgtcggcgagctttccactccgcgatgg
cctggttccggcgtccacaatcgtgctcccaacgcccacaacggtccagcaaggggacca
ttcgacggtacgtccgaggcctacctcggcgacacagtcgcctccccgtccgcgcgacac
aagatcgccagccacacagccatcactagccgcctctcttgcgacattgacgtctccaaa
gatggactcgccaaagatgagctcgtcggactcgtcaaagatggactcgccaaagatgga
ctcgccaaagagcccagtcttaccccgactagaatccatactccctccttcgccggggag
tgctcaaaaacccctccaaacccctcgcgccacaacccttcccacgacatcctcaagcaa
ttcgccgtcaaggacttttcgcaccttccacctagtccatcatctgcctcaatcaatcag
ttcctccgcgcaagtggctccacccaaaatatctcttccggcactcctcccggcagcgcg
tccgcctcaaacgcctactttccatccaaaggcgttcagcgtgaagactctcaaaaatcg
caaaagtcccaaaaacagcaacggacaacgccaaaaccgaaagagctggatccgaatgtc
gacgaggcgctgaggaaactcgatgggcttaccggcacccccggaaagaacaaggcaaag
gggaaatcatcaggcggtccctctgctgccagttcacgccctggtacccctgttgccgaa
agcaagagcaggtctgaaggcaagatcccttctaaaccaagtattggctccttcaaggac
gctacgggttccccactcagtaactggattgacttgactgaagatctccccgccattcct
attccacgcgcacgtatcccgcccaatcgcgagtcctcttcctctgcgagcgtaaccgac
cagcccgaagagacggagaagagtgttccgccggtacccccgcttccccaggtgtacgtc
aacaagaagcagagcatgcccgcacagtctagcgccatgcgaccgcccagctacgtgccc
atgcgtgaaccttcacccgagccgcctgctgtatcttcaccttttgaacccggatcacca
tcgactaccgcacccgtgcccgtgcccgcccaaccaaagatgcacaaaaagtggtccttc
tcctcggcgctcaacctcaaatcggcggcatcgtctgcatcctcggtggacgagatgaga
atgacgacaccgcaaagtccccagacgccatggtctgaaatccatcgcgccgaactcttc
tccccgagctctagtgttcacggcaaagagtcggcaggtggtgattccggtccgcagggt
gcaacacctctcgcaccgccttcatcaaaggcttccaacgtcaacaaacgcctcacgcct
tcttcgatccccttcttccgccgatcctcatcctcttcattccaaagcaaggctagtcaa
tcggtagcgcctctgcccgtgccgttgcccgagacgcccaaacagactgagaagacggcc
gccgtcccaagctcccagtcgcgcaagtcggtgctggggatgcatttcccgtccatgctt
agaggaagctcgtcaaaacgcggtctggcgcagcaaacgagtcaatcccaagtttctgca
aagggaaaggaagaggtcaagcctacaagtgcgccgagcgcgagcgcgacgtcggggtgg
actggccggaaacgtggaaagacactctccatatctggagatcttccaaacccattccca
ggcctcaagcaccagtcttcagcggacagctcctttggaacccgtggttcagcggtttca
agcaatagcgatgcgacgaccatcagcggcagcaacacatttgaccgtttgcctgcgata
atgggctcgcctgctcgacctccggaaggtgcgaggtactccaactctccgagaaacttg
ccttccaccacgcctaccaagattcctcggatgacccaacgcccggctccatcgccggcg
actgtgaccgcccacagcgggatgccgcctcccccattccctacgaccaggaaaatcagc
aacaccgtatcgggcgcaggcgagcaacagcagcgcggcggtcctcctgtatcagagttt
ggcatggtcgacggtataccacatatgccaacgacgcctcgcctgactacttcaggtgct
caccgagctcatttgcttgctcccatgtcggcccgacaagagacgcgtcgcgtgaacaat
cggccttttgatccgcccccacgcagcaaagaagcgtacaccggcgccgtcccgccttcg
agaaggcacctccctcaaccaccgcccgcatcgactgtcaccagcatgacgctttccgcc
agcgccaagcgcgcaagccgagagttcaagaacaagcggcgggaatccaaggacggacag
gacgggtcctcctctgggaaaaactcgcctgtcaagccatcaaaatctatgcactcaagc
atggctgtgccgagctcttcccgcctgccttcttcctattccgctggtactcccggttcg
aattaccgcaagctgtctttggccgactcgtcgccctcgatgagtcccgcggacgatgat
gaagctagtggagatgcggagatggaggcttatatcaagaggcgacgagagcgcgcagcg
gcgaataagaaggatgacctgtcggatgtgaccgagttcccgagggatatcacccctgtt
gagcccctctctcagcgcgcgttcatcaccaggaaccttgcaaagatgtctgacgcagaa
aggaaggaggtgctcgatttcgactatatctattacagtcccaccccaggtacgatccgt
cggccgtctcagccgggaggagccatgttcaatcacggatatgatgatgagcgaggtgat
tatctcgtggtggagggtgatcatctttgttataggtacgaagtggtcgtccaatgtcgg
gaccataaaacgggcaagtcggtagcagttaaaatcattaggaacaagaaacggttccat
actcaagcgctggtggaagtcaagatcttgcagcagttgattgaatgggaccccgaagac
aaacatttcatggtccgtatgactgatagcttttctttccgcaaccatctctgtatcgtc
acagagctcttgagcatcaatctttacgagcttatcaaagcaaaccactttgccggcttt
tcgacagtgctcatcaggaggtttaccacccagatgctgggttccttgcagttgatgaga
tcacacaggatcgttcactgtgacttgaagcccgaaaatatcctgctctgtcacccctcg
aagagcgcgatcaaggtgattgattttggaagcagttgcttggagacagagaaggtttac
acttatatacaatcccgcttctatcgaagtccagaagttattctcggcatgaactacgcc
atggcgattgacatgtggtctctaggctgcattcttgccgagctctatacaggtgttccc
attttccccggggaaaacgaacacgagcagctggcctgtatcatggaagtcctcggtgtg
cccgatcgctatttgattgaaaaggcatcacgacgtaaaaactttttcgacgctaccggt
gcacctcgtcctttcgtcaatgccaagggtcgacgacgacgtcctggatccaagacccta
gccggcgtcctcaaatgcgatgacgagcttttcgtcgatttcattgcccgctgtctcact
tgggatcccgataagcgcctcaaacctcaacccgctatgcgtcatccttggatcctggca
gggcgaaggcgttacgcgccaacacctagccgcgacgaaaaacgtgccactactactgag
cgatcttcgcgattgttcgggacctcacatacgtcgacaagaatcagttcgaagaatctc
tcagaattatcaacttctagcatgaaagacaaggataaatctaaactcctcatttcctcg
ccggtgcctttggcgcctgcaaagcacccatatcacgcctcgaccgcttcgacatcaagg
attggccaagccatgagctcttcaaggcttgctcatcaaacttctgccagaagtggctct
ctcactacctcaaaactcagcattggctaa

DBGET integrated database retrieval system