KEGG   Cryptococcus neoformans JEC21: CNI01400Help
Entry
CNI01400          CDS       T00243                                 

Definition
choline kinase
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CNI01400
Enzymes [BR:cne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     CNI01400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:join(415007..415302,415358..415412,415454..416135,416184..416257,416316..416702,416773..416838)
Genome map
AA seq 519 aa AA seqDB search
MVVTPTRPPVEPSGPPLSPLALASTAPRNSSDSYFAAQAGSRPLPRHRRTSGSSFSKLSE
FSLDPPLLDKTDQYAASPDQIDENGVTGVRHVALSVDASEWRQPVFKQKVLAILRRLHVP
RWSSTLLTPTNIHLQKVSGALTNAVFFVSFNPAPNPTSPSESPLLTPTIPPSDPSHPPPL
TPDQYPHTLLFRVYGPSSEALISRSEELRILHVLSTQYGIGPRVFGTFTNGRVEEFFPSR
ALTAQELRDPSISRGIARRMRELHSVDLRRLGYEQGRATEPALWICLKEWSEAAEDVITS
LTALGGTLEAWVERFSLHRIREEVTIYRNFVESQSGKGSGVVFAHNDTQYGNLLRLDVEL
PPNTPEHCRYIVIDFEYASPNPRGYDIANHFHEWRANYHHPTHSHSLIPHFPYPTPIQRE
DFYRSYLSVEVDGRNGEEVVGKRKDVPADKVAALEREVRIWSPGCSINWALWGLVQAEEQ
VCALATKKEGYVPEFDYLSYAAERLEMFRDEAKKLGVPL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggtggtcacccccacccgtccccccgtcgagccatccggcccccccctctcccccttg
gcactcgcctccactgccccccgaaacagctcggactcatacttcgccgcccaagccgga
tcaaggccgctgcccaggcacaggaggacatcaggaagcagcttctcaaagctgtccgag
ttcagcttggaccctccgcttctcgacaaaacggatcagtacgctgcctcgcctgaccag
atcgatgaaaacggcgtcacaggcgtccggcatgtggcgctgagtgtggatgccagcgaa
tggcggcagccagttttcaagcaaaaagtcctagccatcttacgacgccttcacgtcccg
agatggtcctctacactcttgacacccaccaacatccatcttcaaaaagtctcgggggcc
ttgacaaacgccgtcttctttgtctctttcaatcccgctcccaacccaacttcgccttcc
gaatcgcccctgctaacccctaccattcctccatctgatccatcccaccccccaccgctc
actcccgaccagtacccccacacccttctcttcagagtctatggcccttcctctgaggca
ctcatctcccgatcggaagaactacgtatactccacgtccttagtactcaatatggcatt
ggccccagagtttttggcacttttaccaatggccgggtcgaggaattcttcccatcacgc
gctttgaccgctcaagagttacgcgaccccagtatttctcgtggcattgcccggcggatg
cgcgaacttcactcggtggacttgcgtcgcttgggatacgaacaaggtcgcgctacggag
cccgctttatggatatgtctcaaagaatggtctgaagcagcggaagatgtcatcacctct
ttgacggccctcggcggaacattggaagcatgggtagagcgtttctctttacatcgtatc
cgggaagaagtcacaatctaccggaactttgtagaatcgcaaagtggaaagggcagtggc
gttgtgtttgctcacaacgacacgcagtatggaaatctgttacgcctcgatgttgagctt
ccgcccaacactcccgaacattgccgttatattgtgattgactttgaatatgcttctccc
aacccccgtgggtacgatatcgccaaccatttccacgaatggcgagccaattaccaccat
ccaactcattctcactccctcattcctcatttcccctaccccacacctattcagcgtgaa
gacttttatcgatcatacttgtccgtcgaagttgacggaagaaacggcgaagaagtggtg
ggcaaacgcaaggatgttccagcagacaaggttgctgctcttgaacgtgaagtaaggatt
tggagcccggggtgcagtataaactgggcgttgtggggtttggttcaagctgaagaacag
gtctgtgccttggccacgaagaaggaagggtatgtcccagaattcgattatctctcgtac
gccgctgagcgacttgaaatgtttcgggacgaagccaagaagcttggagttccgttatag

DBGET integrated database retrieval system