KEGG   Cryptococcus neoformans JEC21: CNI01430Help
Entry
CNI01430          CDS       T00243                                 

Definition
cyclin-dependent protein kinase regulator
Orthology
K06634  
cyclin H
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:cne00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    CNI01430
  Replication and repair
   03420 Nucleotide excision repair
    CNI01430
Transcription machinery [BR:cne03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CNI01430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:join(421049..421243,421324..421550,421600..421792,421849..422270,422325..422631)
Genome map
AA seq 447 aa AA seqDB search
MALSGQATPSEAGPSKSSLIPGPSAYHESSQFRHWRFSPSTLNRIRSELNTKSVEVARRN
TELEKEAQKSLGHDIADPPPAATYLTVNDELLLLRFYCSQVSRICREGFGLPEVVESTAI
SYVKRFYLKNSVMEWHPKIIMPTCLYLAAKTTNFPIPADQFVSKIPKLTPEDVLEKEFLV
AQSLSFEFWVRGADKALRGWTLDMQDQQNPPLEAIQKAIAPAFTHLSTSYLSDAEFIFTP
SQISLACLRMADRKLVEGFLEERYAAHAAAIASKSMNGVEESENGTPVQGPAPLYGMEKV
RLLEILDQIEAIIRAVAVELDVKKVKEVDKRLRQCTNPEKIPGTALYVKRKQEKEAADAA
AKATKTLKSQSSAADSDMFFGGSLPLANGQSKSRVPLSPRVNLNSNQKAGGAEMEISDTG
MGIQGESGGLLMGGKGLKDVGLPLSKD
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggccctttcgggacaagctacaccctcagaggccggtccatcgaagtcttctctgatc
ccaggtccttcggcttaccatgaatcttcacaattccgtcactggcgcttttccccgtcg
actttgaatagaatacggtcagagttgaataccaagtcggtcgaagtggctaggaggaac
acggaactagagaaggaagctcagaaatcactagggcatgacattgccgatccaccacca
gccgcaacttatcttacagtcaacgacgaacttttgcttctccgcttttactgttcacag
gtatctaggatctgccgggaaggctttggtcttccagaggtggtagaatctacagcaatc
agttatgttaagaggttctacctcaagaacagtgtcatggaatggcatcccaagatcatc
atgccaacgtgcctttatctagctgccaaaacgacaaattttccaatcccagcggaccaa
ttcgtgtccaagatcccgaaactcactccggaagatgtcttggagaaagagtttctggtc
gctcaaagcctgtcgttcgagttctgggtgcgtggggcggataaggctttgagaggctgg
acattggatatgcaagatcaacagaatccgccactagaagcaatccaaaaggccatcgca
ccagcttttacacatctctccacatcctacctttcagatgccgaatttatcttcacacct
tcacaaatatctttagcttgcttgaggatggcggacagaaagctggttgagggctttttg
gaagagcggtatgctgcccatgcggctgcgatcgcttcaaagtcaatgaacggcgttgaa
gaaagcgagaatgggacaccagttcaggggcctgcacctctatatggtatggagaaagtc
aggctcttggaaatccttgaccaaattgaagccataatccgggcagttgccgtcgagttg
gatgtcaagaaggtgaaggaggttgataagcgattgagacaatgtaccaaccctgaaaag
atcccgggaactgccttatatgtcaagcgaaagcaagagaaagaagcagcagacgcagca
gctaaagcaactaaaacactcaagtctcaatcttccgccgcggatagcgacatgttcttt
ggtggttctcttccattggccaacggtcagagcaaatcaagggtccctttgtccccccga
gtcaacctcaatagtaaccaaaaggctggaggcgctgaaatggaaataagcgacacagga
atgggtattcagggggaaagtggagggctgctaatggggggcaaagggttgaaggatgta
ggcctaccattatcgaaggattag

DBGET integrated database retrieval system