KEGG   Cryptococcus neoformans JEC21: CNI02420Help
Entry
CNI02420          CDS       T00243                                 

Definition
uricase (Urate oxidase) (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cne00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:join(665075..665111,665164..665238,665295..665366,665434..665451,665516..665652,665705..665840,665895..665957,666010..666286,666342..666462)
Genome map
AA seq 311 aa AA seqDB search
MSHPGYLSAARYGKDLVKVARVVRDGEQHHIVEYTLRVLLEGEIETSYTEADNSCVVATD
TVKNTCNIFAKTSPYVLDAPVFALHLGLHFVTKYKHIHKCFVDIIGLKWSRISVDGKPHK
WSFIRDGDEKAIVECVVDGTAGPDAATANVKIGIKDLLVLKTSGSAFENFHRDENTTLAD
VADRIFSTSVSLQCSISLPPNTPLTIDNLGSIAKELDFPKMKELILKDVLDTFATDESAS
VQATLYLTLQKILASCPAVKDASMQLPNKHYIPVNLSAFGLDNKLGYEGGAEVFYPAADP
SGYITATVTRK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtcccatcctggttacctctccgctgctcgatacggtaaggaccttgtaaaggtcgca
cgagtcgtccgtgatggtgagcaacaccatatcgttgagtacaccctccgagtcctcctt
gaaggcgagattgagacctcttacacagaggccgacaactcctgcgtcgttgctaccgac
actgtgaagaacacttgcaacatctttgccaaaacctccccttacgtccttgatgcccct
gtctttgccctccatcttggtttgcactttgtcaccaaatacaagcacatccataagtgt
tttgtggacataattggccttaagtggagccgcatctctgtcgacggcaagcctcacaag
tggtccttcatacgagacggtgacgaaaaggcgattgttgaatgcgttgtggatggcact
gccggccccgacgctgccaccgcgaacgtgaaaattggtatcaaggatcttcttgtttta
aagacgagcggatcagctttcgaaaacttccaccgagatgagaataccactcttgctgat
gttgcagaccgtattttctctacatccgtctctctccaatgctctatttcccttcctcct
aatacccctctcaccatcgacaaccttgggtctattgccaaggaactcgatttccctaag
atgaaggagcttatcctcaaggatgtcctcgacacttttgctaccgacgaaagcgctagt
gttcaagctactctttacctcactctccagaagattttggcttcatgccctgccgtcaag
gacgcttctatgcagttacccaacaagcactacatacctgtcaaccttagtgcttttggc
ttggacaataaattgggttacgaaggtggtgctgaggtcttctaccctgctgccgatccc
agcggttacatcacggccactgtcaccaggaaataa

DBGET integrated database retrieval system