KEGG   Cryptococcus neoformans JEC21: CNI02980Help
Entry
CNI02980          CDS       T00243                                 

Definition
protein serine/threonine kinase
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:cne00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    CNI02980
Enzymes [BR:cne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CNI02980
Protein kinases [BR:cne01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   CNI02980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:complement(join(811523..811707,811766..812923,812981..813341))
Genome map
AA seq 567 aa AA seqDB search
MDPPRASSTRSSSSSMPTSSSASASANKLKKFKLDPMSMLLPHERPGYRGSPAAGRSMPP
LHPQFQLQSQPGSPAYFAMLQSQQVQQDSGTQRIGIQTRTTASVGEQGGKRGEGSGSQIP
TQVPVGSQHPAQGVPLSPPASMASTPPSGSWEDSASQWSSMEGVVEGTPAPGQRSQPSRH
YAPRMTQNTMRLEDWEIVETLGTGTFGRVLLVRQRPSYRPTPYHPIFPHLYRSRHPFSPS
PSTTQKSDDHLPHFAMKVLRKSEIVRLKQVEHINSERIILERVRHPFIVELHATYQDQIN
VYMLLSYIPGGELFSHLRRAGRFSADVTRFYLASIVLAIEYLHSQNIIYRDLKPENLLLD
RHGYLRIADFGFAKVVQDRTFTLCGTPEYLAPEIVLSQGHGKAVDWWALGILGFEMLAGY
PPFFDDHPLGIYEKILRGDIAFPSHVDPYAKDLIRGFLTADRSKRLGNLRGGAKDVMGHP
WFAGVDWRSLERKEIGAPIVPRVASMGDSQNFQRYPPPRPQDLPGVFGQTYNTSNDPCGE
LFSDFSFPGGGSERGSASESTEVLSRD
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggatccaccccgcgcatcctccactcgctcttcatcctcctcaatgcctacctcaagc
agcgcctcggcgtccgcaaataagctcaaaaagtttaagcttgatccgatgtcaatgctt
ttacctcatgaacgtccaggctaccgtggatctcctgccgccggtcgaagtatgcctccc
ctacatcctcaattccaactgcaatcccaacccggttcaccggcgtactttgcaatgttg
cagagccaacaagtacaacaggattctgggacacaaaggatcgggattcagacgcggacg
acagctagtgtgggtgaacagggtgggaagcgcggagaaggcagtggcagtcagattcca
acccaagttccagttggttcgcagcacccagcacaaggtgtaccgttatcgcctcctgcg
tcaatggcatcaactccaccgtccgggtcctgggaggattccgcctcccagtggagctca
atggagggtgttgtcgaaggcacgcctgcacccggacaacgatcccagcctagtcggcat
tatgccccgcgaatgactcagaacacaatgaggttggaagattgggaaatcgtcgagact
ctgggtactgggacctttggacgagtcttacttgttcgacaacgaccttcttatcgaccg
acgccatatcaccccattttcccccatctctatcgctctcgccatcctttctcaccgtca
ccctctacaacgcaaaaatctgatgatcatctccctcatttcgccatgaaagtccttcgc
aagtcagaaattgtgaggttaaagcaagtggaacacatcaactctgagcgaattatcctt
gagcgtgtacgacatccatttatcgtcgaactgcatgccacctaccaggaccagatcaat
gtctatatgctcttgtcttacattccaggtggcgaactcttctcacaccttcgacgggcc
gggcgattctccgccgacgtcaccaggttctatctcgcgtctatcgttcttgccattgaa
tacctccattcgcaaaacattatctaccgtgatcttaaacccgaaaatctccttctcgat
cgtcacggctacctccgcatcgcggattttggctttgccaaagtggtgcaagaccgtaca
ttcactttatgtggtactccggaatatcttgctccggagatcgttctctcccaaggccat
ggcaaagctgtcgactggtgggctcttggtatcctcggttttgaaatgcttgctggttat
ccccctttctttgatgatcatccgctcggtatctacgaaaagattctccgcggagatatt
gcatttccttcacatgtcgatccttatgccaaagatctcattagggggtttttgacagcg
gatcgaagtaagaggttaggcaacttgaggggcggggcgaaggatgtaatgggacatccg
tggtttgcgggtgtggattggagaagcctagagaggaaggaaattggagctccgatcgtc
cctcgagtggctagcatgggcgattcacagaatttccagcggtatccacctccccgacca
caagaccttccgggtgtatttggccaaacgtacaacacatcgaacgatccatgtggcgag
ctattttcagacttcagtttccctggaggagggagcgagagggggtctgcgagtgaatct
actgaggtcttgagtcgggattag

DBGET integrated database retrieval system