KEGG   Cryptococcus neoformans JEC21: CNI03350Help
Entry
CNI03350          CDS       T00243                                 

Definition
yeast yak1
Orthology
K18670  
dual specificity protein kinase YAK1 [EC:2.7.12.1]
Organism
cne  Cryptococcus neoformans JEC21
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:join(909105..909296,909337..909690,909739..909998,910044..910286,910342..910577,910636..910769,910828..912126)
Genome map
AA seq 905 aa AA seqDB search
MPPPQTIPSRSGAGSAVDRRSSSAVSKREEEFRDIRGLADLRAVVNALPNGRRADPDAPG
KYLSPLKCLTSSLPETYTLCNPSFRYVTSDNPRRVLTKPSKPVHNDGADNEDWDYILYVN
DVLGGEDGRDRYLILDVLGQGTFGQVVKCQNMRTHDLVAVKVVKNKPAYLQQSKMEVAIL
ELLNTQHDPQDRHHILRMHDSFTHKHHLCLVFECLSSNLYELIKQNQFKGLSTQLVKVFT
QQLLDCLSVLKDARLIHCDLKPENILLKSLQSPQIKVIDFGSACHEMQTVYTYIQSRFYR
SPEVLLGLPYSTSIDMWSLGCIVVELFLGLPLFPGTSEYNQISRIVDMLGNPPSHLLEVG
KQTHEFFNITPDAYGRNTYKLKPMQQYSMEHRTDEQPSKQYFKQTKLKDVIMEYPYAKKS
AKQSDIDKEMATRRSFVDFAEGLLNMDPIKRWSPQQALKHPFITGEKWTGPWQPDATTTA
KKLPVSSAESSPSTSTPSKKYGGLVQSPPSSRSQRIYSDAAAYNQQLAQHQSYTAQVQAQ
QNAQRAGPFSSGYDIAQAQAPAHTHAAGGGGGGSGYGHQRVVSQQMPSTASHHHHAQQRQ
PSGQWGQQVAPPSSAGYQQRGPSVNNSGSHASLRQPPSNVPVISNPPPNSYYPASRHRAN
TINQMDAIPPALARLVHFGAQDPNGSRNSLTPVLNRDDAIREWERRQQGGHSKQSSLHNA
SYPQLEYLQEQAELAAMQGQNWMMPGPYPPHHGRGHVHRSSLGEQSHGHGHRTNPSGQYQ
MQPHIGISPSNDYRPRPTSEYDPPSSTSSARGYGLPTYPPLAATTSHPPGGSVSGAVGTG
QGVFDAFDGRDGGMGMLYTPLQPNQAYGYQGHAGQHGQGHATRASYSGPYSSSNPFANQP
NSPRY
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atgccacctcctcagactataccatcccgttccggtgcagggtcagcggtcgacaggaga
agctcaagtgcagttagcaagagggaagaagagtttagagatatcagaggattggctgac
ttgcgggctgtggtcaatgcgcttcctaatggacgtcgagcggatcctgatgcgccaggg
aaatacttgagccctcttaaatgccttacatcatctcttcccgaaacctacaccctctgc
aacccttccttccgttatgtcacgtctgacaaccctcgtcgtgttcttacgaaaccgagt
aaaccagtgcataacgatggcgcggataatgaggattgggattacattctgtatgtgaac
gatgtacttggtggggaagatgggagggatcggtacttgattcttgatgtgttgggtcag
ggtacgtttgggcaggttgtcaaatgccagaatatgaggacgcacgatttggtggcggtt
aaagttgtcaaaaataaacctgcttatttgcagcagagtaagatggaggtggcgatcctt
gagctactgaacactcaacacgacccgcaagatcgacatcacattctccgcatgcacgat
tcgtttactcacaagcaccacctttgcctggtgtttgaatgtctctcgtcgaatctgtac
gaacttatcaaacagaaccaattcaaggggttaagtactcaattggtcaaggtgtttact
cagcaactgttggattgtctgtcagtgttgaaggacgcgaggttgatacactgcgatttg
aaaccggaaaacattctgcttaaatcgctacaatcgccacaaattaaagtaatcgacttt
ggctcagcatgccatgaaatgcaaaccgtttacacatatattcaatcccgattttatcgt
tcgcccgaagtcctgctgggtctaccctactcgaccagtatcgatatgtggtctttggga
tgtattgttgtagagttgtttttagggttgccgctgttccctggaacgagcgagtataat
caaatcagtagaatcgtggatatgcttggaaacccaccaagccaccttctcgaagttggt
aaacaaacacacgaattcttcaacatcactcccgacgcctatggtcggaacacctacaag
ctcaaacccatgcagcaatactctatggaacataggacggacgagcagccgtctaaacaa
tatttcaagcagaccaagttgaaggatgtgatcatggaatatccttatgcgaaaaaaagt
gccaagcagagtgatatcgataaagaaatggcaacgagaagaagttttgtggactttgct
gagggtttgttgaatatggatccgatcaagaggtggtctcctcagcaagcattgaagcac
ccgttcattactggcgaaaaatggactggtccatggcagcctgacgcaactaccaccgcc
aagaaactcccagtgtcatcagccgaatcctctccatccacttcgaccccttccaaaaag
tacggcggccttgtccaaagtcctccctcttcgcgatctcaacgtatctattcggatgcc
gcggcttataatcagcaacttgcgcagcatcagtcatatactgctcaagtgcaagcacag
cagaacgctcagagagcagggccgttctcatctggttacgatatagcgcaggcgcaggcc
ccagcacatacacacgctgcaggcggtggtgggggaggatcaggatatggacaccaaaga
gtcgtcagtcaacagatgccttcaacggcatcgcatcatcatcatgcgcaacagagacag
ccttcgggccaatggggtcagcaggtggctcctccatcgtctgcgggttaccaacagcgt
ggtccatcggtcaacaattctggttcgcacgcttccctccgccaacctcccagtaatgtc
cccgtcatctccaaccctcctcccaactcgtattacccggcttctcgtcatcgtgcaaat
acgatcaaccaaatggatgctatccctcctgccctcgcacggctggtgcatttcggtgct
caagatccgaacggttctcgaaactcgttaacgccagtgttgaaccgtgatgatgcgatt
agggaatgggagaggaggcagcagggtgggcacagtaagcagtcatcattgcacaatgct
tcttacccacaactggaatatctgcaagagcaggcagagctagcggcgatgcaggggcag
aattggatgatgcccgggccatatcctccgcaccatgggcgtggacatgttcaccgatct
tcacttggcgaacaatctcacggccatgggcacagaacaaatccttcagggcaataccaa
atgcagcctcacatcggtatctccccatcgaacgattatcgaccccgacccacaagtgag
tacgaccctccatcgtctacttcatccgccagaggatacggtttacccacataccctcct
cttgcggcgacgacgagccacccccctggcgggagtgttagcggcgcagtcgggactggg
cagggagtgtttgatgcgtttgatggacgcgacggaggaatgggaatgttatatactcct
ctccagcctaatcaagcttacgggtaccaagggcatgcggggcagcatgggcaggggcat
gcgactcgagcgagttattcgggaccgtatagctcgagtaatccgtttgcaaaccaaccc
aacagcccaaggtattaa

DBGET integrated database retrieval system