KEGG   Cryptococcus neoformans JEC21: CNJ01080Help
Entry
CNJ01080          CDS       T00243                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CNJ01080
   01230 Biosynthesis of amino acids
    CNJ01080
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CNJ01080
   00030 Pentose phosphate pathway
    CNJ01080
   00051 Fructose and mannose metabolism
    CNJ01080
   00052 Galactose metabolism
    CNJ01080
  Energy metabolism
   00680 Methane metabolism
    CNJ01080
Enzymes [BR:cne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CNJ01080
Protein phosphatases and associated proteins [BR:cne01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CNJ01080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10:join(307384..307555,307612..308112,308166..309120,309178..309849,309914..310358)
Genome map
AA seq 914 aa AA seqDB search
MSDSPAATPLPKDPEGITEQIQSVSTPPPPPQAQKPARQKKIAVLTSGGDSAGMNAAVRA
IVRQSIARGCQAYIIREGWEGLVRGNTSGPTPAPTAPQSPTLSASSKTVTFSSLPPSQQF
DKLTSTLNKESLANEVSFSDPNEVTPLEDTPLSFGYGQLLRDGAGEGDVEELASHGMQGL
AIADREDEKGRSLKNKYIVRVGWDDVRGWQGEGGTLIGSSRCPAFRTREGRLQAASNLIH
SGIDCLAVCGGDGSLTGADKLRGEWPSLVEELYTENKITDDQREAYHHLNIVGLVGSIDN
DMALTDLTIGALTALHRICESIDSISSTASSHSRAFVIEVMGRHCGWLALLAGIATGADF
IFIPEDPPKCEDWETEMCDLLQAHRKVGKRKSIVIVAEGALDRNLKPIKPDYVKKILVER
LGLDTRVTTLGHTQRGGKPCAFDRILPTLQGVEAVQTLLSATPETPSYMIGIQENKITKI
PLLEAVARTQMVAEAIENRDFAKAMSFRDSEFREMLQAFQISSSLDVSQNAPVDKRLRIG
IIHVGAPAGGMNAATRQAVRFCHNRGHVPVAIYNGFEGLLDDNVSELSWLRVDSWTTRGG
SELGTNRSLPSIDIGSVAAGFQRYSLDALLVIGGFEAFHSVVLLSQNRTNYPAFQIPIVH
LPATLSNNVPLTDFSLGSDTSLNALVEACDAIKQSASASRNRVFVVETQGGMSGYIATMG
ALAVGAVLVYTPENGISLKLLQEDVEFLIKRYKLDEKGKSEGRLVIKAEKSSSVYTTETL
TKIFKEEGKDLFDARSASLGHTLQGGVPSPLDRTRAARLSLRCMQFLEEHASPNSQASHH
KPKSAAHPHAGAKSIAKDTAAMIAIIGSKVVYATMDDVLKVTDMKLRRGTDEWWSDCKEL
AETMGGRTGLMAKH
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgtccgactcgccggccgccaccccgctccccaaggacccggaaggcatcacagagcag
attcagtctgtttctacccctccccctcctccgcaggcgcagaaacccgcgaggcagaag
aagattgcagtcttgaccagtggtggtgactcggctggtatgaacgctgctgtccgagca
atagtccgccaatccatcgcccggggatgtcaagcctacatcatccgtgaaggctgggaa
ggtctcgtccgcggcaacacttccggccccacccctgcacccaccgccccgcaatccccc
accctttccgcctcctccaaaaccgtcaccttctcctctttgcccccctcccagcaattc
gataaactcacatctactttgaacaaggaatcactcgccaacgaagtctccttctccgac
ccgaacgaggtcaccccgctcgaggatacgcccctcagtttcgggtacggccagctcctg
agggacggagcgggtgaaggcgatgtggaagagttggcatcgcatggaatgcagggcttg
gcgattgctgatcgcgaagatgaaaagggcaggagtttgaagaacaagtatatcgtcagg
gttgggtgggatgatgtcaggggttggcaaggtgaaggcggtaccttgatcggcagttct
cgatgccctgctttccgcacaagggaaggccgactccaagcggcttccaaccttatccat
tccggcatcgactgtctcgccgtctgcggtggtgacggttccttgaccggtgccgacaag
ctccgcggcgaatggcccagcttggtggaagagctctacaccgaaaacaagattacagac
gatcagagggaagcttaccaccacctcaacattgtcggcctcgtcgggtccattgacaat
gacatggccttgaccgacttgacgatcggtgcgcttaccgccttgcaccgaatctgtgaa
tccatcgattccatctcgtccaccgcgtcctcccactcgcgtgcgtttgtgattgaagtc
atgggcagacactgcggctggctcgcgctgctcgccggtatcgcaaccggtgcagacttc
atcttcatccccgaagacccgcccaagtgcgaggactgggagacggagatgtgtgacctc
ttgcaagctcatcgaaaagtcggtaaacgcaagtcgatcgtcatcgtcgccgaaggcgcc
ctcgacaggaacttgaaacccatcaagccagactatgtgaaaaaaatcctcgtcgagcgt
ctcggtctcgatacccgtgtgaccacactcggacatacacagcgtggtggtaaaccctgt
gcgttcgacaggatcttgcccaccctccaaggcgtcgaggcggttcagacgctgttgagc
gctacacccgagacaccctcgtatatgatcggtatccaggaaaacaagattacgaaaatc
ccgcttctcgaggcggtcgcgcggactcagatggtggcggaagcgattgagaaccgggat
ttcgcaaaggccatgtctttcagagactcggaattccgagagatgctccaggctttccag
attagctcgtcacttgatgtcagccagaatgctcccgtggacaaacgattgaggatcggt
atcatccacgtcggtgcgcctgctggtggtatgaacgctgctacccgacaagccgtccga
ttctgccacaaccgaggccacgtccccgtcgccatctacaacggtttcgaaggtctcttg
gacgacaacgtctccgagctctcctggctccgggtcgactcgtggacgacccgaggcggt
tccgagcttggtacgaaccgatcgttaccttccatcgatatcggctccgtcgccgccggt
ttccagcgatactccctggacgccttgttggtcattggtggattcgaagctttccactct
gtcgtcctcctctcacaaaaccgaaccaactacccagccttccagatccccatcgtccac
ctcccagcgaccttgtcgaacaatgtacccctcacagacttttcactcggttccgatacc
tcgctcaatgcgctcgtggaagcttgtgatgccatcaagcagagtgcctcggctagtagg
aacagggtgttcgtggtagagacccagggcggaatgagtgggtatatcgcgacgatgggc
gcgctcgccgttggagctgttttggtgtacacgcccgagaatgggatttccttgaagctt
ttgcaagaggatgtagagttcttgatcaagaggtacaagttggatgagaagggtaagagt
gagggtaggttggtcatcaaagccgaaaagtcttcctctgtgtacaccaccgagactctc
accaagatcttcaaggaagaaggtaaagacctctttgacgcccgttccgcttcgctcggc
cacaccctccaaggcggtgttccctctcctctcgaccgaacccgtgccgcccgtctctca
ctaaggtgcatgcaattcctcgaagaacacgcatctcccaactcccaagcctcgcaccac
aagcccaagtctgccgcccacccgcatgcaggtgcgaaatccatcgcaaaggatacggcg
gcgatgattgcgattatcggtagcaaggttgtgtacgcgacgatggacgacgtgttgaag
gtgacggatatgaagctgaggaggggaacggacgagtggtggagtgactgtaaggagttg
gcggagacgatgggtggaaggaccggtttgatggccaagcattga

DBGET integrated database retrieval system