KEGG   Cryptococcus neoformans JEC21: CNJ01080Help
Entry
CNJ01080          CDS       T00243                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CNJ01080
   01230 Biosynthesis of amino acids
    CNJ01080
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CNJ01080
   00030 Pentose phosphate pathway
    CNJ01080
   00051 Fructose and mannose metabolism
    CNJ01080
   00052 Galactose metabolism
    CNJ01080
  Energy metabolism
   00680 Methane metabolism
    CNJ01080
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CNJ01080
Enzymes [BR:cne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CNJ01080
Protein phosphatases and associated proteins [BR:cne01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CNJ01080
Messenger RNA biogenesis [BR:cne03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CNJ01080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10:join(307384..307555,307612..308112,308166..309120,309178..309849,309914..310358)
Genome map
AA seq 914 aa AA seqDB search
MSDSPAATPLPKDPEGITEQIQSVSTPPPPPQAQKPARQKKIAVLTSGGDSAGMNAAVRA
IVRQSIARGCQAYIIREGWEGLVRGNTSGPTPAPTAPQSPTLSASSKTVTFSSLPPSQQF
DKLTSTLNKESLANEVSFSDPNEVTPLEDTPLSFGYGQLLRDGAGEGDVEELASHGMQGL
AIADREDEKGRSLKNKYIVRVGWDDVRGWQGEGGTLIGSSRCPAFRTREGRLQAASNLIH
SGIDCLAVCGGDGSLTGADKLRGEWPSLVEELYTENKITDDQREAYHHLNIVGLVGSIDN
DMALTDLTIGALTALHRICESIDSISSTASSHSRAFVIEVMGRHCGWLALLAGIATGADF
IFIPEDPPKCEDWETEMCDLLQAHRKVGKRKSIVIVAEGALDRNLKPIKPDYVKKILVER
LGLDTRVTTLGHTQRGGKPCAFDRILPTLQGVEAVQTLLSATPETPSYMIGIQENKITKI
PLLEAVARTQMVAEAIENRDFAKAMSFRDSEFREMLQAFQISSSLDVSQNAPVDKRLRIG
IIHVGAPAGGMNAATRQAVRFCHNRGHVPVAIYNGFEGLLDDNVSELSWLRVDSWTTRGG
SELGTNRSLPSIDIGSVAAGFQRYSLDALLVIGGFEAFHSVVLLSQNRTNYPAFQIPIVH
LPATLSNNVPLTDFSLGSDTSLNALVEACDAIKQSASASRNRVFVVETQGGMSGYIATMG
ALAVGAVLVYTPENGISLKLLQEDVEFLIKRYKLDEKGKSEGRLVIKAEKSSSVYTTETL
TKIFKEEGKDLFDARSASLGHTLQGGVPSPLDRTRAARLSLRCMQFLEEHASPNSQASHH
KPKSAAHPHAGAKSIAKDTAAMIAIIGSKVVYATMDDVLKVTDMKLRRGTDEWWSDCKEL
AETMGGRTGLMAKH
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgtccgactcgccggccgccaccccgctccccaaggacccggaaggcatcacagagcag
attcagtctgtttctacccctccccctcctccgcaggcgcagaaacccgcgaggcagaag
aagattgcagtcttgaccagtggtggtgactcggctggtatgaacgctgctgtccgagca
atagtccgccaatccatcgcccggggatgtcaagcctacatcatccgtgaaggctgggaa
ggtctcgtccgcggcaacacttccggccccacccctgcacccaccgccccgcaatccccc
accctttccgcctcctccaaaaccgtcaccttctcctctttgcccccctcccagcaattc
gataaactcacatctactttgaacaaggaatcactcgccaacgaagtctccttctccgac
ccgaacgaggtcaccccgctcgaggatacgcccctcagtttcgggtacggccagctcctg
agggacggagcgggtgaaggcgatgtggaagagttggcatcgcatggaatgcagggcttg
gcgattgctgatcgcgaagatgaaaagggcaggagtttgaagaacaagtatatcgtcagg
gttgggtgggatgatgtcaggggttggcaaggtgaaggcggtaccttgatcggcagttct
cgatgccctgctttccgcacaagggaaggccgactccaagcggcttccaaccttatccat
tccggcatcgactgtctcgccgtctgcggtggtgacggttccttgaccggtgccgacaag
ctccgcggcgaatggcccagcttggtggaagagctctacaccgaaaacaagattacagac
gatcagagggaagcttaccaccacctcaacattgtcggcctcgtcgggtccattgacaat
gacatggccttgaccgacttgacgatcggtgcgcttaccgccttgcaccgaatctgtgaa
tccatcgattccatctcgtccaccgcgtcctcccactcgcgtgcgtttgtgattgaagtc
atgggcagacactgcggctggctcgcgctgctcgccggtatcgcaaccggtgcagacttc
atcttcatccccgaagacccgcccaagtgcgaggactgggagacggagatgtgtgacctc
ttgcaagctcatcgaaaagtcggtaaacgcaagtcgatcgtcatcgtcgccgaaggcgcc
ctcgacaggaacttgaaacccatcaagccagactatgtgaaaaaaatcctcgtcgagcgt
ctcggtctcgatacccgtgtgaccacactcggacatacacagcgtggtggtaaaccctgt
gcgttcgacaggatcttgcccaccctccaaggcgtcgaggcggttcagacgctgttgagc
gctacacccgagacaccctcgtatatgatcggtatccaggaaaacaagattacgaaaatc
ccgcttctcgaggcggtcgcgcggactcagatggtggcggaagcgattgagaaccgggat
ttcgcaaaggccatgtctttcagagactcggaattccgagagatgctccaggctttccag
attagctcgtcacttgatgtcagccagaatgctcccgtggacaaacgattgaggatcggt
atcatccacgtcggtgcgcctgctggtggtatgaacgctgctacccgacaagccgtccga
ttctgccacaaccgaggccacgtccccgtcgccatctacaacggtttcgaaggtctcttg
gacgacaacgtctccgagctctcctggctccgggtcgactcgtggacgacccgaggcggt
tccgagcttggtacgaaccgatcgttaccttccatcgatatcggctccgtcgccgccggt
ttccagcgatactccctggacgccttgttggtcattggtggattcgaagctttccactct
gtcgtcctcctctcacaaaaccgaaccaactacccagccttccagatccccatcgtccac
ctcccagcgaccttgtcgaacaatgtacccctcacagacttttcactcggttccgatacc
tcgctcaatgcgctcgtggaagcttgtgatgccatcaagcagagtgcctcggctagtagg
aacagggtgttcgtggtagagacccagggcggaatgagtgggtatatcgcgacgatgggc
gcgctcgccgttggagctgttttggtgtacacgcccgagaatgggatttccttgaagctt
ttgcaagaggatgtagagttcttgatcaagaggtacaagttggatgagaagggtaagagt
gagggtaggttggtcatcaaagccgaaaagtcttcctctgtgtacaccaccgagactctc
accaagatcttcaaggaagaaggtaaagacctctttgacgcccgttccgcttcgctcggc
cacaccctccaaggcggtgttccctctcctctcgaccgaacccgtgccgcccgtctctca
ctaaggtgcatgcaattcctcgaagaacacgcatctcccaactcccaagcctcgcaccac
aagcccaagtctgccgcccacccgcatgcaggtgcgaaatccatcgcaaaggatacggcg
gcgatgattgcgattatcggtagcaaggttgtgtacgcgacgatggacgacgtgttgaag
gtgacggatatgaagctgaggaggggaacggacgagtggtggagtgactgtaaggagttg
gcggagacgatgggtggaaggaccggtttgatggccaagcattga

DBGET integrated database retrieval system