KEGG   Cryptococcus neoformans JEC21: CNJ01080Help
Entry
CNJ01080          CDS       T00243                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:cne01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cne01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cne00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cne00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cne00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cne00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:cne00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10:join(307384..307555,307612..308112,308166..309120,309178..309849,309914..310358)
Genome map
AA seq 914 aa AA seqDB search
MSDSPAATPLPKDPEGITEQIQSVSTPPPPPQAQKPARQKKIAVLTSGGDSAGMNAAVRA
IVRQSIARGCQAYIIREGWEGLVRGNTSGPTPAPTAPQSPTLSASSKTVTFSSLPPSQQF
DKLTSTLNKESLANEVSFSDPNEVTPLEDTPLSFGYGQLLRDGAGEGDVEELASHGMQGL
AIADREDEKGRSLKNKYIVRVGWDDVRGWQGEGGTLIGSSRCPAFRTREGRLQAASNLIH
SGIDCLAVCGGDGSLTGADKLRGEWPSLVEELYTENKITDDQREAYHHLNIVGLVGSIDN
DMALTDLTIGALTALHRICESIDSISSTASSHSRAFVIEVMGRHCGWLALLAGIATGADF
IFIPEDPPKCEDWETEMCDLLQAHRKVGKRKSIVIVAEGALDRNLKPIKPDYVKKILVER
LGLDTRVTTLGHTQRGGKPCAFDRILPTLQGVEAVQTLLSATPETPSYMIGIQENKITKI
PLLEAVARTQMVAEAIENRDFAKAMSFRDSEFREMLQAFQISSSLDVSQNAPVDKRLRIG
IIHVGAPAGGMNAATRQAVRFCHNRGHVPVAIYNGFEGLLDDNVSELSWLRVDSWTTRGG
SELGTNRSLPSIDIGSVAAGFQRYSLDALLVIGGFEAFHSVVLLSQNRTNYPAFQIPIVH
LPATLSNNVPLTDFSLGSDTSLNALVEACDAIKQSASASRNRVFVVETQGGMSGYIATMG
ALAVGAVLVYTPENGISLKLLQEDVEFLIKRYKLDEKGKSEGRLVIKAEKSSSVYTTETL
TKIFKEEGKDLFDARSASLGHTLQGGVPSPLDRTRAARLSLRCMQFLEEHASPNSQASHH
KPKSAAHPHAGAKSIAKDTAAMIAIIGSKVVYATMDDVLKVTDMKLRRGTDEWWSDCKEL
AETMGGRTGLMAKH
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgtccgactcgccggccgccaccccgctccccaaggacccggaaggcatcacagagcag
attcagtctgtttctacccctccccctcctccgcaggcgcagaaacccgcgaggcagaag
aagattgcagtcttgaccagtggtggtgactcggctggtatgaacgctgctgtccgagca
atagtccgccaatccatcgcccggggatgtcaagcctacatcatccgtgaaggctgggaa
ggtctcgtccgcggcaacacttccggccccacccctgcacccaccgccccgcaatccccc
accctttccgcctcctccaaaaccgtcaccttctcctctttgcccccctcccagcaattc
gataaactcacatctactttgaacaaggaatcactcgccaacgaagtctccttctccgac
ccgaacgaggtcaccccgctcgaggatacgcccctcagtttcgggtacggccagctcctg
agggacggagcgggtgaaggcgatgtggaagagttggcatcgcatggaatgcagggcttg
gcgattgctgatcgcgaagatgaaaagggcaggagtttgaagaacaagtatatcgtcagg
gttgggtgggatgatgtcaggggttggcaaggtgaaggcggtaccttgatcggcagttct
cgatgccctgctttccgcacaagggaaggccgactccaagcggcttccaaccttatccat
tccggcatcgactgtctcgccgtctgcggtggtgacggttccttgaccggtgccgacaag
ctccgcggcgaatggcccagcttggtggaagagctctacaccgaaaacaagattacagac
gatcagagggaagcttaccaccacctcaacattgtcggcctcgtcgggtccattgacaat
gacatggccttgaccgacttgacgatcggtgcgcttaccgccttgcaccgaatctgtgaa
tccatcgattccatctcgtccaccgcgtcctcccactcgcgtgcgtttgtgattgaagtc
atgggcagacactgcggctggctcgcgctgctcgccggtatcgcaaccggtgcagacttc
atcttcatccccgaagacccgcccaagtgcgaggactgggagacggagatgtgtgacctc
ttgcaagctcatcgaaaagtcggtaaacgcaagtcgatcgtcatcgtcgccgaaggcgcc
ctcgacaggaacttgaaacccatcaagccagactatgtgaaaaaaatcctcgtcgagcgt
ctcggtctcgatacccgtgtgaccacactcggacatacacagcgtggtggtaaaccctgt
gcgttcgacaggatcttgcccaccctccaaggcgtcgaggcggttcagacgctgttgagc
gctacacccgagacaccctcgtatatgatcggtatccaggaaaacaagattacgaaaatc
ccgcttctcgaggcggtcgcgcggactcagatggtggcggaagcgattgagaaccgggat
ttcgcaaaggccatgtctttcagagactcggaattccgagagatgctccaggctttccag
attagctcgtcacttgatgtcagccagaatgctcccgtggacaaacgattgaggatcggt
atcatccacgtcggtgcgcctgctggtggtatgaacgctgctacccgacaagccgtccga
ttctgccacaaccgaggccacgtccccgtcgccatctacaacggtttcgaaggtctcttg
gacgacaacgtctccgagctctcctggctccgggtcgactcgtggacgacccgaggcggt
tccgagcttggtacgaaccgatcgttaccttccatcgatatcggctccgtcgccgccggt
ttccagcgatactccctggacgccttgttggtcattggtggattcgaagctttccactct
gtcgtcctcctctcacaaaaccgaaccaactacccagccttccagatccccatcgtccac
ctcccagcgaccttgtcgaacaatgtacccctcacagacttttcactcggttccgatacc
tcgctcaatgcgctcgtggaagcttgtgatgccatcaagcagagtgcctcggctagtagg
aacagggtgttcgtggtagagacccagggcggaatgagtgggtatatcgcgacgatgggc
gcgctcgccgttggagctgttttggtgtacacgcccgagaatgggatttccttgaagctt
ttgcaagaggatgtagagttcttgatcaagaggtacaagttggatgagaagggtaagagt
gagggtaggttggtcatcaaagccgaaaagtcttcctctgtgtacaccaccgagactctc
accaagatcttcaaggaagaaggtaaagacctctttgacgcccgttccgcttcgctcggc
cacaccctccaaggcggtgttccctctcctctcgaccgaacccgtgccgcccgtctctca
ctaaggtgcatgcaattcctcgaagaacacgcatctcccaactcccaagcctcgcaccac
aagcccaagtctgccgcccacccgcatgcaggtgcgaaatccatcgcaaaggatacggcg
gcgatgattgcgattatcggtagcaaggttgtgtacgcgacgatggacgacgtgttgaag
gtgacggatatgaagctgaggaggggaacggacgagtggtggagtgactgtaaggagttg
gcggagacgatgggtggaaggaccggtttgatggccaagcattga

DBGET integrated database retrieval system