KEGG   Cryptococcus neoformans JEC21: CNJ01180Help
Entry
CNJ01180          CDS       T00243                                 

Definition
stearoyl-CoA 9-desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cne01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:cne01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10:complement(join(331547..332503,332560..333010,333059..333290,333343..333487))
Genome map
AA seq 594 aa AA seqDB search
MSAAVPPMTPPLEKEESELVHRRPSPVDQLDPAFTPPHTPEQNPCKSTKGKGIDPIDPTL
LASDRHIPDNYVSYTIANQKYLPPITWKNLIYNIQWISFLALTVTPSLAIYGVFTTAWNT
KTAIWSVIYYFITGLGITAGYHRLWAHRAYNASVPLQFALAIAGTGAVEGSIKWWCRGHR
AHHRYTDTELDPYSAEKGFFWSHVGWMLVKPRGKIGVADVSDLSRNRVVKWQHRHYIPLI
LGMGFVLPTVVAGLGWGDWRGGFFFAGAARLCFVHHSTFCVNSLAHWLGEQPFDNKHSPR
DHIITALCTIGEGYHNFHHQFPQDFRNAIKWFQYDPTKWFIWTMSQLGLASHLKRFPDNE
VKKGQYTMKLRLLKEQADQLEWPKSSNDLPVISWDDFKAEAKERSLVAIHGFIHDCSSFV
EDHPGGAHLIKRAIGTDATTAFFGGVYDHSNAAHNLLAMMRVGILDGGMEVEHLKRRPAE
SAASSVTNSPVSSASASSVDIQSLADDDFRLDQTQLNSQGPKPKAPFGQPQAQVADRWTL
SVPPSEKLRIVQTVPEIRPGLLTHRSTGKLNKVTKADVGGEINEFIGEKPVAAA
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccgccgttccgcccatgacccctcctctcgagaaggaagagagtgagcttgtt
cacaggcgaccctctcctgttgatcaactcgatcctgccttcacaccgcctcatactccc
gaacagaacccttgcaaatcaaccaagggcaagggaatcgaccccatcgaccccactctc
ctcgcttctgaccgacatattcccgataactacgtctcctacactatcgccaaccaaaaa
taccttcctcctattacatggaaaaacttgatctacaacatccagtggatctccttcctc
gcactcaccgtcactccttctctcgctatatatggagtgtttaccaccgcctggaatact
aagactgctatttggagtgttatctactatttcatcactggtctcggtattaccgctggt
taccaccgtctttgggctcaccgtgcctacaatgccagtgttcctcttcaattcgctctc
gccattgccggtaccggtgctgttgaaggttccatcaagtggtggtgccgaggtcaccga
gcccaccaccgttacaccgacaccgagcttgacccttactccgctgagaagggcttcttc
tggtctcacgttggatggatgttggtcaagccccgaggcaagatcggtgtcgccgatgtc
agtgatttgagcaggaacagggtcgtaaaatggcaacacaggcattacattcccttgatc
ttgggtatgggtttcgttctccctactgttgtcgctggtcttggctggggagactggagg
ggtggtttcttctttgctggtgcggccaggttgtgctttgtccaccactctactttctgt
gtcaactctcttgcccattggcttggtgagcagcccttcgacaacaagcactctcctcga
gaccatatcatcactgctctttgcaccattggcgagggctaccacaacttccaccatcaa
ttccctcaggacttccgaaacgctatcaagtggttccagtatgaccccactaagtggttc
atctggaccatgtctcagctcggtcttgcctctcacttgaagcgtttccctgacaacgag
gttaagaagggtcagtacaccatgaaattgcggcttctcaaggagcaggccgaccagctt
gaatggcccaagtctagcaacgaccttcctgttatcagttgggacgatttcaaggctgaa
gccaaggaacgctctcttgttgctatccacggtttcattcacgactgttcttctttcgtt
gaggaccaccctggtggtgcccacctcatcaagcgtgctatcggtactgacgccactact
gccttcttcggtggtgtctatgaccattccaacgctgctcacaacttgctcgctatgatg
cgtgtcggtatccttgatggtggtatggaggttgaacatctcaagcgacgtcccgccgag
tctgcggcttcctctgtcaccaactctcctgtctcttccgcctctgcctcctctgtcgac
atccagtctctcgccgatgacgacttccgtctcgaccagactcaactcaattctcagggc
cccaagcctaaggctcctttcggtcagcctcaggctcaggttgctgacaggtggacgctt
tctgtgccccctagtgagaagttgaggatcgtccagactgtacccgaaatcagaccggga
ttgttgactcaccgatcgaccggaaagctcaacaaggtcaccaaggctgatgtcggcggt
gagattaacgagttcatcggggagaagcctgtggctgcggcttag

DBGET integrated database retrieval system