KEGG   Cryptococcus neoformans JEC21: CNJ01930Help
Entry
CNJ01930          CDS       T00243                                 

Definition
dolichyl-phosphate-mannose-protein mannosyltransferase
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    CNJ01930
Enzymes [BR:cne01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     CNJ01930
Glycosyltransferases [BR:cne01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   CNJ01930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10:join(562564..562893,562962..563364,563417..563685,563753..564521,564581..564961,565027..565070,565129..565356)
Genome map
AA seq 807 aa AA seqDB search
MHRGIPSPPATRRHTAIQHTPWENRVPPSAYGSARPHSAFLEATPHDDAELPLFKDTNME
LKRRFDEKQPVHLEQPVVDDDQGKWEKGYGAGPGIGGRRGLPPRQRIPGWKGIVQEHEEW
VWAGVYTLLSMITRFWRIGAANYVVWDEAHFGKFGTHYIKRDFYFDVHPPLGKMLVGLAG
LLSGYQGNFEFKSGVAYPEDVPYTAMRVMLASFGVALVPLAWFTSGELGWSRWTRHWVTI
CVLCDIGWLCISRFILLDSMLLFFTFTTTLGLVKFRNQRHAPFSDDWWIWLVFTGWSIGC
VCSVKWVGMFITALVGLYTIEDLWEKFGDLSMPIRTYITHWVARITCLIILPFIVYASCF
KIHFLILNRSGPGDAQMSSLFQAHLRGNDFAESPLEIAYGSTVTLKNYGYGGGLLHSHVQ
TLPVGSLQQQVTCYHYKDENNNWQIVPPWGADPVDPDGPIRFLKDGDEIRLVHTQTGRNM
HSHAIAAPVTKESWEVSGYGNLTIGDENDLWIVEVVDDTHTSKKNNEDGRIHSLTTRMRL
KHRQLNCYLRAANAVLPQWGFKQVEVSCTKENNPKDLHTYWNVESHWNDRLPAGNAKLYK
SPFWRDFVHLNVAMWTSNNALVPDPDKEDILASQPFDWPFLHLGLRMCGWGDHQIKFYLL
GTPIIWWFSTISLAIGLGLAAWYVARMQRGYKEWKAGEWDHWLWAGKVAFGGWALHFFPF
LIMGRVTYLHHYLPTLYFAVLMAGHILDHFFFASSTRSHTKKLIWFAVWAGVVILSFWWF
KDLALGISGNVNNHWGWGWRSSWNIYN
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atgcacaggggcataccatccccgccagcaacacgcagacacacagccatacaacacact
ccctgggagaacagagtacctccctccgcctacggctcagcacgcccacacagcgctttc
ctcgaggcaacgccccacgacgacgcagagctcccgctcttcaaggacaccaatatggag
ctcaagagacgtttcgatgaaaaacaaccggtgcatctagagcagcctgtcgtggacgac
gaccagggcaagtgggaaaaggggtacggcgcgggaccaggaatcggcgggcgaagaggt
ctgccgcctagacagagaataccgggatggaagggtatcgtgcaggaacacgaagaatgg
gtatgggcaggggtctacactttgctgagtatgattacgcgattctggcgcatcggtgcc
gccaactacgtcgtctgggacgaggctcatttcggcaagtttggaacacactacatcaaa
cgtgatttctactttgatgtccacccgccgctcggcaagatgctggtcggtcttgcaggt
ttgctctcaggctaccagggcaactttgaattcaagtcgggtgttgcgtacccggaagat
gtgccgtacacggcgatgagagtcatgttggccagctttggtgtggctctcgtgccgctt
gcttggtttacttctggagaattgggatggagcaggtggacaaggcattgggtgaccatt
tgtgtcctgtgtgacatcggatggctttgtatttcccgatttattctcctcgactccatg
cttttgttcttcacctttacgacgactcttggtcttgtcaagttccgcaaccaacgacat
gccccatttagcgacgactggtggatctggcttgtcttcacgggatggtcgatcggttgt
gtgtgtagtgtcaagtgggtgggaatgtttatcaccgcgcttgtcggcctttacacgatt
gaagatttgtgggaaaagtttggtgacctttccatgcccattcgcacgtacatcacccac
tgggttgcccgaatcacctgccttataatccttccctttatcgtctacgcttcgtgcttc
aaaatacacttcctcatcctcaaccgatcgggccccggtgatgcccaaatgtcttccctc
ttccaagcccatttgcgtggtaacgactttgccgagtctcctctcgaaatcgcctacggc
agtaccgtcaccttgaaaaactatggctatggcggtggtttactgcattcgcacgtgcag
actttgcccgtgggaagtctccagcaacaggtcacgtgttatcactacaaggacgagaat
aacaactggcagatcgtacctccttggggcgctgatcctgttgatccagacggaccgatt
aggttcctgaaggacggcgatgagatccgactcgtgcatacccaaactggacggaacatg
cactctcacgctatcgctgcgccagtcaccaaggagagctgggaagtctctgggtatggt
aatcttaccattggcgacgagaatgatctttggattgtcgaggtcgtcgatgatacccac
acatccaagaagaataacgaagacggtcgtatccactcgttgaccacacgaatgaggctc
aagcaccgccaactgaattgttacctccgcgccgccaacgccgtcctgcctcagtggggt
ttcaagcaggtagaagtttcctgtacaaaagaaaacaatcccaaggatttacacacgtac
tggaacgtcgaatctcactggaacgatcgattgcccgctgggaacgccaagctgtacaaa
tctcccttctggcgcgactttgtccacctcaacgttgccatgtggacatccaacaatgct
ctcgtcccggacccggacaaggaagacattctcgcttcacaaccattcgactggccattc
ctccatcttggtcttcgtatgtgtggctggggcgatcaccaaatcaaattttacctcctc
ggcacacccatcatctggtggttctcaactatcagcttggctattggtttaggtctggct
gcttggtatgtggcgaggatgcagagggggtacaaggagtggaaagcgggagagtgggat
cattggctttgggcgggtaaggtggcgtttggtggctgggctttgcatttcttccccttt
ttgattatgggtcgagttacctatcttcaccattatcttcctacattatactttgctgtt
ctcatggccgggcacatcctcgaccacttctttttcgcttcctccacccgctcacacact
aaaaagctcatttggtttgccgtctgggcaggagtggtgatactgagcttctggtggttc
aaggacctcgcgcttggtatctctggtaacgtgaacaatcactggggatggggatggagg
tcatcttggaatatctacaactga

DBGET integrated database retrieval system