KEGG   Cryptococcus neoformans JEC21: CNJ01940Help
Entry
CNJ01940          CDS       T00243                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CNJ01940
   00670 One carbon pool by folate
    CNJ01940
Enzymes [BR:cne01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CNJ01940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10:complement(join(565537..565951,566015..566159,566217..566433))
Genome map
AA seq 258 aa AA seqDB search
MFPPGTTCKSNSTPSQHRCMRPLLNALRTMQTTAKSSTPSITAVVAATAENGIGLNGGLP
WRLPGEMKYFARVTTGETPSSDPSEQNVVIMGRKTWESIPSRFRPLKNRRNVVISGKGVD
LGTAENSTVYTDIPSALSALRSTTESGHSPRIFLIGGATLYTSSLLPSSVPSLNSSTSTS
PLPFSRPLIDRILLTRILSPFECDAYLEDFAAHTKPDGSKVWKKASIKEFREWIGWDIEE
QVEEKGVKYIFEMWVLNQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgttcccccccggcacgacttgcaaatccaactcgactccatcccagcaccggtgtatg
cggccgctcctcaacgccctccgcacgatgcagaccacagccaagtcgtccaccccgagc
ataacagccgtcgtcgcagccacggccgagaatggcatcggtctcaacggtggcttgcca
tggagattaccaggcgaaatgaagtactttgctcgagtcaccaccggcgagacaccttca
tcagatcccagcgaacagaatgtagtcatcatgggccgcaagacatgggaatccatccct
tccaggttcagacctttgaaaaaccgccggaacgtggtcatctcaggtaaaggcgtggac
ctgggaacggcggaaaattctactgtctacactgacataccctctgccctctccgccttg
cgttctaccacggaaagcggccattcaccccgtatattcctcatcggcggcgcaaccctc
tacaccagctctctcctcccgtccagcgttccctctctcaactcgtcaacctccacatct
cctcttcctttttcccggcccctgatcgaccgtattctcctcactcgaatcctttcccct
tttgaatgcgacgcgtatcttgaagactttgcggcacacacaaaacctgatgggagcaaa
gtttggaaaaaggcttccatcaaagaatttagagaatggattggatgggatatcgaagaa
caagttgaagaaaagggggtcaagtacatattcgagatgtgggtgttgaatcaatag

DBGET integrated database retrieval system