KEGG   Cryptococcus neoformans JEC21: CNJ02230Help
Entry
CNJ02230          CDS       T00243                                 

Definition
calcineurin A catalytic subunit
Orthology
K04348  
serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
cne  Cryptococcus neoformans JEC21
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10:complement(join(650918..651319,651369..651721,651768..651859,651909..652037,652097..652314,652364..652426,652465..652504,652555..652670,652721..652819,652870..652895,652939..652997,653076..653221,653425..653568))
Genome map
AA seq 628 aa AA seqDB search
MASPATQTANAIAAINNRSNLVIPEIDFTQHQLENGEIVSTTERVIKDVQAPAMYVPTDD
QFWSTTDKTKPDIAFLKNHFYREGRLTEEQALYILEKGGELLRSEPNLLEVDAPITVCGD
IHGQYYDLMKLFEVGGNPADTRYLFLGDYVDRGYFSIECVLYLWSLKMWYPDTLFLLRGN
HECRHLTDYFTFKLECNTSTPRLFTMPAWRQFLCIHGGLSPELHTLDDLRSINRFREPPT
QGLMCDILWADPLEDFGSEKTNENFLHNHVRGCSYFFTYNAACQFLERNNLLSVIRAHEA
QDAGYRMYRKTKTTGFPSVMTIFSAPNYLDVYSNKAAVLKYESNVMNIRQFNCTPHPYWL
PNFMDVFTWSLPFVGEKITDMLIAILNCCTKEELEEEEEEFPLHAPEPTDAESAAERRQI
IKNKILAVGRMSRVFSLLREESERVSELKSISGSNALPAGMLASGAEGIKEAIQGFEDAR
KSDIENERLPPDIIDPDEDKPASPSASPIMPATPEEIPSEIPYDSPITGTPRTPISGAIA
FGSPGSPGTPTSPSIGGPPLTAWRPGHGRRTSLGTTKTSPSTRRRSLENTMHLIRDVVGG
KDAQGDGQLERLAEVISSPTKGGQGERE
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggcttccccagccactcagaccgcgaatgccattgcggccatcaacaaccgctcaaac
cttgtcatcccggagatagactttacccagcaccagcttgagaacggtgaaatcgttagc
accactgagagggtcatcaaagatgttcaagccccagcgatgtatgtaccgaccgacgac
caattctggtccacgacggataaaaccaagcccgatattgcatttttaaagaaccacttc
tatcgggaaggaaggttgactgaggagcaagctttgtatatccttgaaaagggtggagag
ctcttgagatcagaaccaaacttgctggaagttgacgcgcctatcactgtgtgcggtgat
attcacggtcaatattacgatttgatgaagctcttcgaggtcggcggaaacccggcagac
actcgttatctcttcttgggagactacgttgatcgaggatacttttctattgagtgtgtg
ctttatttgtggtcgctcaagatgtggtatcccgatactcttttcctgctgagaggtaat
cacgagtgccgacacttgaccgactatttcaccttcaagctagagtgcaacacaagtact
ccgagactgtttacaatgcctgcatggagacaattcctgtgcatccatggtggtttgtcg
ccagagcttcataccctcgatgatctgcgatctatcaatcggttccgagagcctcccact
caaggtcttatgtgcgatatcctttgggctgatccgttagaagactttggctcagaaaag
accaacgaaaactttttgcacaatcatgtccgaggttgcagttacttcttcacttataat
gctgcatgtcagttcttggagaggaacaacctgctttctgttattcgagctcacgaggct
caagatgctggttatcgaatgtatcggaaaactaagaccactggcttcccctccgtcatg
accatcttttcagcacctaactaccttgacgtttactctaataaggccgctgtgttgaag
tacgaatcaaacgtcatgaacatccgacaattcaattgtacgccccatccttattggctg
cctaactttatggatgtgttcacctggagtttgcctttcgttggcgagaagattacggac
atgcttattgcaatcctcaactgttgcaccaaggaggagcttgaggaagaggaggaagag
tttcctcttcatgctcctgagcctaccgatgccgaatctgcagcggaaagacgacaaatc
attaagaacaagattcttgctgttggtcgcatgtctcgagtattctctctgctgcgtgaa
gagtctgaaagggtgtctgaacttaagagtatttctggctcaaacgctttacccgctggc
atgcttgccagtggcgctgaaggtattaaagaagcgatccagggctttgaggatgcgaga
aaaagcgatatcgagaatgagaggcttcctcctgacatcatcgaccccgatgaggacaag
cctgcgtcaccttctgcctctcccatcatgcccgccacccctgaagagatccccagcgaa
atcccctacgactctccaatcaccggtactcctcgaactcctatctccggcgctattgct
ttcggctctcccggctctcctggcacccccaccagcccttccattggaggtccgccactc
actgcttggcgacccggccatggccgtcgtacatcgttgggcactaccaagactagcccg
agtacgcgaaggaggagtttggagaatacgatgcacttgatccgagatgtggtgggtggt
aaggatgcccaaggtgatgggcagttggagaggctcgcagaggttatttcgagtccgacg
aagggcggtcaaggcgagagagagtag

DBGET integrated database retrieval system