KEGG   Cryptococcus neoformans JEC21: CNJ03090Help
Entry
CNJ03090          CDS       T00243                                 

Definition
Glycogen debranching enzyme
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CNJ03090
Enzymes [BR:cne01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CNJ03090
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     CNJ03090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10:complement(join(954415..954512,954574..954676,954734..954823,954875..955078,955136..955332,955381..955660,955716..955927,955978..956131,956185..956521,956572..956746,956803..956926,956988..957226,957281..957374,957424..958363,958409..959000,959047..959621,959671..959837,959894..960094))
Genome map
AA seq 1593 aa AA seqDB search
MTILDSLKPSNIEIPKPKAVLQGDGKKTPKTPQDEAISFFSREGDGEPVQVWELSLEDDG
GPSPEKSYIRLPPPFKPYVLRFTLQPGTDVTRNGVLKSDFPMDGGAFKRDDWKERKLPSN
LSKPIEVDLPISAPGAFCYFIEYDSPDSTGRVQGRKGYFNVDPIITLPARTPFFPPDTPI
TSGPLKDESSGAILPKDKQLSLDGLIIISVLAKWMGKTTEWEPFFAEASRRGYNMLHWAP
LQQKGMSGSPYSIQNQLVFDIDLLKDSKAKDGGVKEVEEVLKFAKEKYGLGGVTDVVLNH
TAYDSPWLQEHPEAGYSPYNTPHLAPALEFEDALLGLTSRLSSVGLPTNLKSESDLQALI
PHIKSSIDDAKLWEYYIFDVQGSERAVADSLLNSKPEAPKPWEGSSLQGKSLNELAEIVK
SSDIITSYRAYSSRYCTSVPPAVAAGFIQAAYPGDSAENQASRWGKILDVLNVDLYKECN
EDIQAGIDGVVGRLRYTRLEEGGPKLGELTEERAILERYFTRIPKNDITKKHPENALAVA
NNGWMWAADPLNNFAEYPSKAYLRRQVIVWDDCVKLRYGSQASDNPWLWQHMISYAELLA
GMFDGFRLDNCHSTPLPLGKAIIDAGRRVNPNLYVMAELFTGSQEMDLKFVRELGINSLV
REAYNGNTVKNFADLLWRFGLGKPVGSMDVACLTSSGEVHLSLSSSKSSTRPALVTPLQG
SVPHAVFYDLTHDNQSPRDKRTAEDALSTGALVTFCAAALGSNKGFDDLYPKLLDLVTDN
RKYEVISKEKEKSSGIGNVKRVLNALHVEMMEGGYSEGYVHEDGEYLMIHRIHPVTHKGY
MLVAHTAYPGFKGRGWVKPIRLGRTSISYIFGASIKTRFEEWEDDPSTHRGIPSTLTEIG
PPEITKGIENGEEYQEVVVPEDFAPGSIMVFATQMSDISGDLDAFCKEGAIDAMSQLDLV
DLNVILHRADGEEQDATGGDGTYTIPNYGAITFCGLEGWMHPLREITKKNDLGHPLCQHL
REGTWAFDYVVNRLNKQTFDLPRLEAPAKWFASRFDQIKATAPSFMRPKYFSLVIHEAYK
AARRAVVEQCSEFVSSGHSLTHNLALCSVQMYGLVKSASLDPGRAVPSLAAGLPHFAAGW
ARCWGRDVFISLRGLFLTTGNYPAARAHILSFGSTLKHGLIPNLLDSTRNPRYNCRDGPW
WFIQNIQDYTHMAPNGLTILSDKVKRRFPADDTWVAWDSPRAYEYESSVAELIQEILQRH
AEGIEFREYNAGPNLDMDMRDEGFNQKIWVDWETGIIFGGNRYNCGTWMDKMGSSEKAGN
KGLPATPRDGAPIEITGLLKSALTWLDKLSKGGKFPFKGVNASVKGKKRLVTYKEWSDLI
QASFEKHYYVPSDPAEDDKYVINKGLVNRRGIYKDVFGTPKDREWSDYQLRCNFTLPMVV
APELFTPSKAIGALSIADAVLRAPLGMKTLDPSDSQYRGDYDNSNDGTDQAIAKGWNYHQ
GPEWGFPLGWFLMAYLKFDRLAGEGKSNPTKTMHYISNILRNLARHIESDPWRGLPELTN
SNGSFCYDSCNTQAWSASTILDVLEEMHKIGKN
NT seq 4782 nt NT seq  +upstreamnt  +downstreamnt
atgactatcctcgactccctcaaaccaagcaacatcgagatccccaagcccaaggctgtc
cttcagggcgatggcaagaagactcccaagacaccgcaagatgaagccatttcattcttc
tcgagagaaggagatggtgagccagtgcaggtctgggaactgtcgttggaggatgacgga
ggccctagtccagaaaagagttacattcgacttccgcctcccttcaagccgtacgtcttg
aggtttactcttcagcccggtacggatgtcactcgcaatggcgtgcttaaaagcgacttt
ccgatggacgggggcgcgtttaagcgggatgactggaaagagcgaaagttgccctccaac
ctgagcaaacctatcgaggtcgaccttccgatttccgctcccggagcattctgctacttt
atcgagtatgactcgcccgattccaccggtcgagttcaaggccgaaaaggctactttaac
gttgatcccatcatcactcttcctgctcgtaccccattcttccctcccgatacccccatc
acatctggccctctgaaagatgagtcttcaggtgccatccttcccaaggacaagcagctc
agtcttgatggtcttatcatcatctctgttcttgctaaatggatgggcaaaactacagaa
tgggaaccattcttcgcggaagctagcagaagaggctacaatatgcttcattgggcgcct
cttcaacaaaaaggcatgtctggcagtccctactctattcaaaaccaactggtctttgat
atagaccttttgaaggactccaaggcgaaggatggtggggtaaaggaggttgaagaagtg
ttgaagtttgcaaaggaaaagtacggattggggggtgtcactgacgtggtgttaaatcac
actgcgtatgactcgccttggttgcaggagcaccctgaagctggttattcaccatacaac
actcctcatctcgcccctgctctcgaatttgaggatgctctgcttggcttgacatcaagg
ctctcgtccgttggtctccccaccaacctcaaatccgaatccgacctccaggcgttaatc
ccccacatcaaatcttccatcgacgacgccaaattgtgggagtactacatctttgacgtc
caaggttctgagcgtgctgttgccgattctttgctcaattccaagcctgaagcgcccaag
ccttgggagggatcttcccttcaaggcaagtcactcaatgaactcgccgaaattgtcaag
tcttccgatatcatcacttcttatcgcgcttactcctctcggtactgcacctctgtccct
cccgctgtggctgcaggatttattcaagctgcttacccaggtgattcggcagagaaccaa
gccagtcgatggggcaagatcttggatgtgctgaatgtggacctttataaggaatgtaat
gaggatatccaggctggtatcgatggtgttgtggggaggttgagatatactagattggag
gagggtggacctaagcttggagagcttaccgaagagcgggcgatcctggagcgctacttc
actcgaatccccaagaacgacattaccaagaaacaccccgagaatgccctcgctgtcgcc
aacaacgggtggatgtgggctgctgatcctctaaacaactttgccgaatacccttctaaa
gcctacctccgccgtcaggtcattgtctgggatgattgtgtcaagctccgatacggttct
caagcttctgacaacccgtggctatggcagcacatgatctcctacgccgaacttctcgct
gggatgtttgatggtttccgtttggacaattgtcactctaccccgttgcccttgggcaag
gccatcatcgacgctggtcgacgagtgaacccgaatctctacgtcatggctgaactcttt
actggaagccaggagatggacttgaagtttgtcagggagttgggtatcaacagtctcgtc
agggaggcttacaacggcaacactgtcaagaactttgcggatctcctctggagatttggt
cttgggaagcctgtgggttctatggacgttgcatgccttacatcatcaggagaagtccac
cttagcctttcatcgtcaaagtccagcacccgtccggcgcttgtcacccctcttcaaggc
tctgtgccccacgcagtcttctatgaccttacccacgacaaccagtcccctcgagacaag
cgaactgctgaagatgccttgtctacaggtgctcttgtgaccttttgtgctgccgctttg
ggatccaacaaaggttttgatgacctctaccccaagctacttgatctggtcaccgataac
agaaagtatgaagtcattagtaaggagaaggagaagtctagcggtatcggtaatgtcaag
cgagtgttgaacgcccttcatgtggagatgatggagggtggttactctgaaggctacgtg
catgaggacggcgagtacctcatgattcaccgaattcaccccgtcacccacaagggatac
atgcttgttgctcatacggcttacccgggcttcaaaggtcgaggatgggtcaaacccatt
agactcggtcgaacctctatctcatatatcttcggtgcctctatcaagacccgctttgaa
gaatgggaggacgacccctctactcatcgtggcatcccgtcgacccttacagagattggc
ccccctgagattaccaaaggcattgagaatggagaggagtatcaagaggttgttgtgcca
gaagatttcgctcccggaagcatcatggtctttgctactcagatgagcgatatttctggt
gatctggatgcgttctgcaaagaaggtgctatagatgctatgagccaactggacttggtg
gacctcaacgtcatcctccacagggctgacggtgaagagcaggatgctaccggtggtgat
ggtacttacactatccccaactacggcgccattactttctgcggtcttgaaggctggatg
caccccttgcgagagatcactaagaagaacgatctcggtcatcctctctgtcaacacttg
cgagaaggtacttgggcttttgactatgttgtaaacaggttaaacaagcaaacctttgat
ctccctcgccttgaggctcctgccaagtggttcgcttcccgcttcgatcagatcaaggct
accgccccttctttcatgcgcccaaagtacttctccctcgtcatccacgaagcttacaag
gcagctcgccgagctgttgttgagcaatgctctgagtttgtttcttctggccattcgctc
actcacaatcttgccttgtgctctgtgcaaatgtatggcttggtgaagagtgccagcttg
gatcccggaagagctgtgccaagtctggcagccggcttgccccatttcgccgctggttgg
gctagatgttggggacgagacgtcttcatctctcttcgaggtcttttccttactactggt
aactatccagctgctagggcccatatattatccttcggcagcactctcaaacacggcttg
atccccaacttgctcgactcaacgcgaaatcccaggtataactgtcgcgatggcccttgg
tggttcattcaaaatatccaggattacacccatatggctcccaacggtttgaccatcctc
tctgacaaagtcaagcgccgattccctgcggatgacacctgggttgcttgggatagcccc
agagcgtacgagtatgaaagcagcgtcgctgaattgatccaagagatcttgcagaggcat
gcagagggtattgaattcagggagtacaatgctgggcccaaccttgatatggacatgcgc
gacgaagggttcaaccagaagatttgggttgattgggagactggaatcatctttggtggc
aacagatacaactgtggtacctggatggacaagatgggttcgtctgaaaaggcaggtaac
aagggccttcctgctaccccccgggatggtgctcccattgagatcaccggtctactcaag
agtgcccttacttggcttgataagttgagcaaaggtggcaaatttccttttaagggcgtg
aatgcttctgtcaagggcaaaaagcgtctcgtgacgtacaaagaatggtctgacctcatt
caagcctcttttgagaagcattactacgttcccagcgaccccgctgaagacgataaatac
gttatcaacaagggtttggtcaaccgccggggtatctacaaggatgtatttggaactcca
aaggatagggagtggagtgactaccagcttcgatgcaacttcacgcttccgatggttgtc
gctcctgagcttttcactccttccaaagccattggcgctttgagtattgccgatgctgtg
cttcgcgctcctcttggtatgaagacccttgacccttctgacagccaatatcgaggcgac
tatgacaactcgaacgatggtacagatcaagccattgccaagggctggaactatcaccag
ggccctgagtggggcttccctcttggttggttcctcatggcttacctcaagttcgaccgt
ctcgctggtgaaggcaaatctaatcccaccaagactatgcattacatctccaatatcctt
aggaatctcgcccgccacattgaaagtgacccatggcgaggcttgccggagctaaccaat
agcaatggaagcttctgctatgactcctgtaacactcaggcatggagcgcaagtacgatt
ctcgatgtattggaggaaatgcacaagattgggaagaattag

DBGET integrated database retrieval system