KEGG   Cryptococcus neoformans JEC21: CNK00950Help
Entry
CNK00950          CDS       T00243                                 

Definition
Pol II transcription elongation factor
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
cne  Cryptococcus neoformans JEC21
Brite
Enzymes [BR:cne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CNK00950
Transfer RNA biogenesis [BR:cne03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    CNK00950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11:join(297631..297965,298019..298082,298133..298242,298304..298417,298471..298609,298687..299367,299429..299570,299634..299722)
Genome map
AA seq 557 aa AA seqDB search
MIAPTTSQSELHLLCVSAVVRDLISTYNSSSSSATQPPNVNSLRAKYAKKYGLKAVPRLT
DVLAAVPEEWKDRLRGWLRAKPVRTASGVAVVAVMCKPHRCPHVAMTGNICVYCPGGPDS
DFEYSTQSYTGYEPTSMRAIRARYDPYEQARGRVNQLRDLGHSVDKVEIIIMGGTFMSMP
EDYRHKFIAGLHNALSGHTGEDVDEAVKFSEQSKVKCVGITIETRPDYCLKPHLSQMLRY
GCTRLEIGVQSVYEDVARDTNRGHTVRAVSESFHMSKDAGYKIVAHMMPDLPNCGTERDI
WQFQEFFENPAFRSDGLKLYPTLVIRGTGLYELWRTGKYKNYPPNALVDIVARIMALVPP
WTRVYRVQRDIPMPLVSSGVENGNLRELALARMKDFGAECRDVRYREVGLHEIHHRVRPR
DIELIRRDYAANGGWETFLSYEDPQSDILVGLLRLRKCSEEGTFRKELVGMQGGCSLVRE
LHVYGTAAPVHSRDPKKFQHQGIGTLLMEEAERIAREEHGSGRIAVISGVGTRDYYRRLG
YFLDGPYMVKDLLYDDE
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcacccacaacctcacagtcggaactgcaccttctatgtgtatccgccgtggtc
agagacctcatctcaacctataattcctcaagcagctccgccacccagcctccaaacgta
aacagtcttcgagcaaaatacgcaaaaaaatacggactcaaggcagtccctcgtttgaca
gatgtcctcgctgctgtccctgaagaatggaaggacaggctgaggggatggctgagagca
aagccagtcaggacggcgagcggtgtggcagttgttgctgtcatgtgcaaaccccatcga
tgtcctcacgtagccatgaccggaaacatctgcgtctactgccccggcggtcccgactct
gactttgaatactcaacccagtcatacactggatatgagcctacttctatgcgagccatc
cgggccagatatgacccatatgagcaagcgcgtggacgtgtgaaccagctccgtgacctt
ggacacagcgtcgacaaggttgagatcattatcatgggaggaacgttcatgtccatgccg
gaagactaccgccataaattcattgctggacttcacaatgccttgagtggtcacactgga
gaggacgttgacgaggctgtcaaattctctgagcaaagcaaggtcaaatgcgttggtatc
actattgaaactcgtcccgattactgcttgaagcctcatctgagtcagatgttgaggtat
ggatgcacccgtctggaaatcggtgttcaatcagtctatgaagacgtggcacgagacacc
aaccgaggacacactgtccgagctgtcagtgaatccttccacatgtccaaagacgccggc
tacaagattgtcgcccacatgatgcctgacctccccaactgcggtaccgagcgagacatt
tggcaattccaagaattctttgaaaaccccgctttccgctcagacggtctcaaactgtac
ccaaccttggtcatccgtggtaccggtctttacgaactgtggaggactggcaagtacaag
aattaccctcccaacgcccttgtcgatatcgtagcgaggatcatggcgctcgtacccccc
tggacgcgagtctaccgcgtccaacgagatatcccgatgccgctcgtctcttccggcgtg
gagaatggtaatttacgtgaactcgcacttgcgcgtatgaaggatttcggtgccgagtgt
cgagatgtgcgataccgtgaggtcggtctgcacgagattcaccaccgtgtgcgaccgcgt
gatatcgagcttatccgaagagattacgcggcgaatggcggatgggagacgttcttgtcg
tatgaggatcctcagtctgatatcttggtcggtcttttgaggttgagaaagtgttcagag
gaagggacgtttaggaaggagttggttggtatgcaaggtggatgcagccttgtgcgagag
ctgcacgtgtatggtactgctgcacccgttcactctcgtgaccccaagaaattccagcat
caaggtatcggtacattgttgatggaagaggcggagcgtatcgcccgtgaggagcacggt
agcggtcggatcgctgtaatctctggtgttggaacgcgtgattactatcgacggcttggt
tactttctcgatgggccttatatggtcaaggatcttttgtacgatgacgagtag

DBGET integrated database retrieval system