KEGG   Cryptococcus neoformans JEC21: CNK01070Help
Entry
CNK01070          CDS       T00243                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cne00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11:join(329056..329103,329166..329185,329237..329327,329390..329416,329470..329882,329939..330025,330082..330148,330205..330303)
Genome map
AA seq 283 aa AA seqDB search
MGVSQNEKSVILTHESGCSAEIYFYGATVVSWKQGGKERMFVSSKSAMDGSKAIRGGIPV
VFPIFGPPPPSPPEYASLGQHGFARTSTWKFDSVVMDRPEGVSVRFVLPSAPPTFLHEFK
LSYVVTLAPHQLSTDLHVVNSGKEKFSFQALLHNYLAVPDSSKIKITGIDKGTTYKDKVL
GGKMDEWDGSTLVIDREIDRVYQKVPSREITVDDGAGSGYKVRFRGFEDCTIWNPQEATG
SKMADMEDKGWDKYVCIEPGYVREFKTLSPSQELILAQTITVL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtctcacaaaatgaaaagagcgtcatacttacccatgaatcagggtgctccgcc
gaaatttacttctacggcgccactgtagtgtcttggaagcaaggcggcaaggaacgcatg
ttcgtgagctccaaatcagccatggacggttccaaggcgatccgaggtggtatccctgtc
gtcttccccatctttggccctcctcctccttctcctccagagtacgcttccctcggacaa
cacggttttgcgcgaaccagtacctggaagtttgactctgtcgtgatggaccgccccgaa
ggtgtctctgtccgattcgtcttgccttctgcgcctccaacgttcctccacgaattcaag
cttagctacgtcgtcactctcgccccccaccaactatctaccgacttgcacgtggttaac
tctgggaaagagaagtttagcttccaggccttgttgcacaattacttggccgtccccgac
tccagcaagattaaaatcactggaattgacaagggtaccacttataaagataaggttctg
ggaggaaagatggatgaatgggatggcagcactcttgtcatcgatcgagaaattgaccga
gtctaccagaaggtgccctcgcgggaaatcactgtggacgacggtgccggatctggttac
aaggtccgattccgaggttttgaggactgtactatctggaaccctcaagaagcgaccggt
agtaaaatggctgatatggaggacaaaggctgggacaagtatgtttgtattgagcctggc
tacgtcagggaattcaagaccttatctccctctcaagagcttatcttggctcagaccatc
accgtgctctag

DBGET integrated database retrieval system