KEGG   Cryptococcus neoformans JEC21: CNK02510Help
Entry
CNK02510          CDS       T00243                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CNK02510
Enzymes [BR:cne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CNK02510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11:729921..730820
Genome map
AA seq 299 aa AA seqDB search
MSKNAQFQPPEATPVILFKTPHPSPSTDPYHHAFSESASSSSNSAEKYQTHFIPVLNETY
HLQEIVKIIEEGPDQWEGVIVTSRRGMEGWVKGVQTYLGGTGKGKEGEGAWDKLPLFSVG
HASTEHLAAANIPPSFKPRPVPEMESNPPKSAGPLSELVLRTLPRRSTGASEVSHGPYLF
LCGDKSLDEMPTALRSEGRTVKEVVVYTTSARHDFQQGLRRLETPVRHKGWLAFFSPSSA
AIVMPQIKQDNGRWDGWRVFAIGETTKKYLEEEAKMEVHAVADRPDAIGTFEAIMKAGR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaaatgcccagttccaaccacccgaagcaacgccggtaatattattcaaaact
ccacatccgtcaccttcaaccgatccctaccaccatgccttttccgaatcagcatcgtca
tcttcaaactctgcggaaaaatatcaaacccattttatcccagtcttgaatgagacatac
caccttcaggagattgtcaaaatcatcgaggaggggcctgaccagtgggaaggggtaatt
gtcactagccggcgaggtatggagggttgggtcaaaggagttcaaacctacttgggaggg
acaggcaagggaaaagagggggaaggggcatgggataaattaccgcttttctctgttggc
catgcgtcgactgagcacttggctgctgccaatataccaccatcgttcaagcctcgtccg
gtacccgagatggaaagcaatcctccgaaatccgctggaccgttgtcggaactggtactg
agaacgttgccgaggagaagtaccggcgcgagtgaggtaagccacgggccatacttgttc
ttgtgcggagacaagtcactggatgagatgcctactgcgctgagaagtgaagggaggaca
gtgaaggaagttgtggtgtacactacgtccgcgcgacacgacttccagcagggtctgaga
cggttagaaacacctgttagacacaaagggtggttggcgttcttttcgcccagctcagcc
gctattgtaatgccccaaatcaaacaggataatggtcgctgggatggatggcgtgtgttt
gccattggagaaacgaccaagaagtatcttgaggaggaggctaagatggaagtgcatgct
gtcgccgacagaccggatgccattgggacatttgaggctataatgaaggcaggaagatag

DBGET integrated database retrieval system