KEGG   Cryptococcus neoformans JEC21: CNL05260Help
Entry
CNL05260          CDS       T00243                                 

Definition
histone deacetylase 3
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cne  Cryptococcus neoformans JEC21
Brite
Enzymes [BR:cne01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CNL05260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12:join(467514..468069,468122..469038,469092..469182,469235..469338)
Genome map
AA seq 555 aa AA seqDB search
MTNLHFGVCSSTNRLHQKNPTNVLLCLVCIISSAQSYISPDYQLMVPSTSSTNHSAFRVS
YLWSPALQRLSDDLPSNVGRSSMVHDLIRSLDLLDFEELKERFLKSDNPEDEDGKSEDDD
DNEADRNEVNNGDKQGADGEPQRRKPGSPTASPPHAQNKKATVVFPQPSLGTKACLLKYH
DRSYIERLLMAHTDRDPNDPTHLPSSPSSSASSPRPAKIARTDPYNLSHDNPVFPTLASY
ISHVTAATSTACRLLATDKADWAVCWDGGRHHAKRKEAGGFCYVNDLVLGGLLLSREGRI
PLPLKEGEDPKRQRTRAPRILYLDMDLHYSDGVSAAFHSPTVYPYPLKEGITPPKPPNVL
TLSVHHSSPIFFPPPTPLSLLPSPDTESPFSLSIPLSAYPSRQTYAKVFNQCIQPIREAW
DPDYIILQLGTDGLPGDRVGQYGNWSVDGEGGIKWVVERVKEWGKKVCVTGGGGYRHDNA
ARAWAEVTGVLLDRDFVEDMPIPHHDHFEQYAPSFTLQVPDSHMRDENKPEDLEKAAEVF
NVLAERIKIIVDANS
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacctccactttggcgtctgctcttccactaaccgtctccatcaaaagaatcca
acgaatgtactgctttgtttggtctgcatcatctcttcagcgcaatcctatatttctcca
gactatcaactaatggtaccatctacaagttcaacaaatcactctgcatttagagtgtca
tacttatggtcgcctgctcttcaacgtctatccgacgacttgccttcgaatgtcggacga
tcaagtatggtgcatgatttgatcagatcactcgacttacttgactttgaagagctgaaa
gagaggttcttgaaaagcgataatccggaagatgaggatggaaagagtgaggatgatgac
gataatgaagcggacaggaacgaagttaacaatggagataaacaaggggctgatggagag
ccccaaagaagaaaaccgggcagcccgactgcgtctccaccccacgcccaaaataagaaa
gccacagtcgtatttcctcaaccaagtctaggtaccaaggcatgtctcctaaaataccat
gatcgctcatacatagagcgccttctaatggctcacaccgacagagatcctaatgatcct
actcatctcccttcttcaccttcgtcatccgcttcttctccccggcctgccaagattgct
cgcacagatccttacaatctctcgcacgacaatcctgtatttccaactttagcgtcgtac
atctcccacgtaacagccgctacatccacggcgtgccgtctgcttgccactgacaaagct
gactgggcggtatgttgggatggtggccggcatcatgcgaaaagaaaagaggctggagga
ttttgttatgtgaatgatctcgtcctgggtggcttgttgctctcccgcgaagggcgaata
ccattaccgttgaaagaaggggaagatccgaagaggcagaggacaagggcaccaaggata
ctctaccttgatatggacctccactactctgatggagtttcagcagccttccactccccc
acagtatatccctaccccttgaaagaaggcataacccccccgaaaccaccaaacgtcctg
accctttccgtccaccactcatctcccatcttcttccctcctcctacacccctctctctc
ctaccctccccagatactgaatctccgttctctctctccatcccactctcagcttaccct
tcccgccaaacatatgcgaaagttttcaaccaatgtatccagccgatccgcgaagcttgg
gatccagactacatcattctccagctcggcactgatggtcttcctggagatagagtgggc
cagtacggaaactggtctgttgatggggaaggagggatcaagtgggttgtggagcgagtg
aaagagtgggggaagaaagtttgtgtgacaggtggaggagggtatagacatgataatgct
gctagagcgtgggccgaggtcacgggcgtcttgctggatagagactttgtcgaggacatg
cctattccccaccatgatcattttgagcagtacgctccgtcttttactctacaagtgcca
gacagccatatgagggacgaaaacaagccagaagatctggaaaaggctgccgaagtgttc
aacgtcctcgctgagagaattaaaatcattgtagacgccaattcatag

DBGET integrated database retrieval system