KEGG   Cryptococcus neoformans JEC21: CNM00240Help
Entry
CNM00240          CDS       T00243                                 

Definition
NADH-cytochrome b5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CNM00240
Enzymes [BR:cne01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     CNM00240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13:complement(join(54346..54421,54507..54670,54746..54804,54859..55004,55054..55148,55203..55359,55420..55504,55584..55686))
Genome map
AA seq 294 aa AA seqDB search
MFTIEVLAQKLAPHASFLGGLVVAAILGLFIFFQEKDRKVLDPVEWRSFKLVDKDHLSHN
TALYRFALPRASDSLGLPIGQHISVAAEINGKQVVRSYTPTTLDDDKGHFDLVVKTYEKG
NISRYLSLLTIGQEIKVKGPKGKFVYTPNMAPHLVMIAGGTGITPMYQIIKSSIKTPGDK
TRLSLIYANIQEDDILLKKEIDELQAKSNGRFDVKYVLNNPPEGWTGGVGFVTKEMIEEA
MPSSGVGSANHGEGHKVLMCGPPPMITAMKGHLAQIGYPAPRSVSKLEDQVFLF
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgttcaccatcgaggttctcgctcagaagcttgctcctcatgccagcttcctcggcggt
ctcgtcgtcgctgctattctcggccttttcatcttcttccaggagaaggacagaaaagta
cttgaccctgttgagtggaggtctttcaagctcgttgacaaggatcacttgtcccacaac
actgctttgtaccgatttgcccttccccgagcatctgattctctcggtctccccatcggt
caacacatctctgtcgctgccgagattaatggcaagcaggttgttagatcttacactccc
accactttggatgacgacaaaggacactttgacttggttgtcaagacatacgagaagggt
aacatctcccgatacctttctctcctcactatcggccaggaaattaaggtcaaaggtcct
aagggcaagtttgtttacacccccaacatggcccctcaccttgtcatgattgccggcggt
accggtatcactcccatgtaccagattattaaatcctctatcaagactcccggcgacaag
accaggctttctttgatctacgccaacattcaggaagatgacatcttgctcaagaaggaa
attgacgagctacaagccaagtccaacggccgttttgatgtcaagtacgttcttaacaac
cctcctgagggctggactggtggtgttggtttcgtcaccaaagagatgattgaggaagct
atgccttcttccggtgttggctctgctaatcacggtgagggtcacaaggtcttgatgtgc
ggccctcctcctatgatcaccgctatgaagggccacctcgcgcagatcggttaccctgct
cctaggagcgtctccaagctcgaggaccaagttttccttttctaa

DBGET integrated database retrieval system