KEGG   Cryptococcus neoformans JEC21: CNM00860Help
Entry
CNM00860          CDS       T00243                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
cne  Cryptococcus neoformans JEC21
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cne00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CNM00860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13:join(251656..251781,251839..251931,251986..252162,252213..252365,252420..252520,252575..252595,252645..252841,252903..253011,253065..253188)
Genome map
AA seq 366 aa AA seqDB search
MLSTFRTGVKDIELANPPTDSISRIEFSPTADILAVASWDNNVRLYDVNSQGQNQGKAMY
SHQAPVLDLTWSADGQYVFSSGCDNAAQMYNVQTQQAQQVAQHDAPIKCVEFAEVPGSGQ
VLITAGWDKKLKYWDLRSPNPIATIDLSDRAYSMSVAQQLLVCATGDRQLHVINLSSPTT
IFKSIESPLKWQTRVVSCFPTGDAFAVGSIEGRVAIQYPGEDDKRNFSFKCHRYDIPTGS
MPRTPAVSGSQNVFAINSLTFHKVQGTFCSGGSDGSLTFWDGISRTKLKTFSCKDLNNGD
TDVRPPRFGTPIVSTSFNRTQEIIAYAMSYDWSKGHSGVPPAGQNINKVMLHPVKPEEVN
KKPKRN
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgctctctaccttccgaaccggcgtcaaggatattgaactcgccaaccctcctacagac
tcaatctctagaatcgaattctctcccaccgccgacatacttgctgttgcgagttgggac
aacaatgtgcggttatacgacgtaaactcgcaagggcagaaccaagggaaggcgatgtac
tctcatcaggctcctgtgcttgatttaacttggtcggcagacggccaatatgtcttctcc
tccggatgcgacaacgctgctcaaatgtacaacgtccaaacacagcaagcacaacaagta
gctcaacatgatgcacccataaagtgtgttgaatttgccgaagtgccgggaagtggacag
gttttgattacagcgggttgggataagaaactcaagtactgggacttgagatcacccaac
cctattgcaactatcgacctctctgatagggcctattcgatgagcgttgctcaacaactg
ttggtctgtgctaccggtgaccgtcaactgcatgtcatcaatctttcaagccctaccacc
atcttcaagagtatcgagtcaccgttgaaatggcaaacacgagttgtcagctgttttcct
actggagacgcattcgctgttggaagtattgagggacgagtagctatccaataccctgga
gaggatgataagcgaaatttctctttcaaatgtcatcgatacgacatccctactggtagc
atgccgcgaactcccgccgtcagcggctcccagaatgttttcgctatcaactctctcact
ttccacaaggtgcagggaactttctgctctggtggcagcgacggtagtttgacattctgg
gacggtatctctcgaacaaagcttaagactttctcctgcaaggatttgaacaacggagac
acagatgtacgaccaccaagatttggtactcccatcgtgtctacttcctttaaccgaacc
caagaaatcatcgcgtatgccatgtcatatgattggtccaagggccacagcggtgtccca
cctgcgggacaaaacattaacaaagttatgttgcaccctgtcaagcctgaagaagtcaac
aagaagcccaagaggaattaa

DBGET integrated database retrieval system