KEGG   Cryptococcus neoformans JEC21: CNM00920Help
Entry
CNM00920          CDS       T00243                                 

Definition
lysophospholipase
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CNM00920
Enzymes [BR:cne01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CNM00920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13:join(275509..275682,275729..275886,275939..276113,276162..276427,276468..276668,276730..277267,277318..277719)
Genome map
AA seq 637 aa AA seqDB search
MSIITTAFALSLLATTAFAVPPETPRIELQAERGLGDQSYAPWQVDCPSNVTWIRNATTG
LGTGERAYIEAREKLVQPAIEQMMAARGLETPPRTPVIGVALAGGGYRAMLTGLGGIMGM
MNESTEASQSETGGWLDGVSYWSGLSGGSWATGSFMSNGGQLPTTLLENLWNIDSNLVFP
DDGKLSFYTNLYTETNAKSDLGFPVQITDIWGLAIGSHVLPEPYQLSNTPNLTFSSLPSV
VAALGNASLPMPIIVAADRKRREAGELVIAENATVWEFTPYEFGSWAFGSQYKSPGAFTP
IEYLGTSVDDGSPNGTCWKGFDQLSFVMGTSATLFNGAFLELNGTDSGLLTNLITAFLAD
LGEDQADISRIPNSFSNYNSGENPIYNLTYITLVDAGETNQNIPLEPLLVPTRDVDAIVA
FDSSYDSDYIWPNGTALRTTYERAKILAEHENTRVLMPEVPSMNGFVNGGYNSRPTFFGC
NDTTTPVIIYIPSYPWSFAANTSTYQLSYENNEANEMLLNGMRSLTLNHSVPTWPTCFAC
ALTDRSFMYTSENRSTTCQECFDTWCWAGDDNTTEPANYEPVINSVPPWLIANNLSIGMA
DAPGSNESTAGTASSGAAKMGVGMGMVALTAGLGLML
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatcatcacgaccgctttcgcgctctcacttctcgccaccactgctttcgctgtt
cctccagagactccgcggattgagcttcaggcggagagaggtttgggtgatcaatcctat
gctccttggcaagtcgattgcccctccaacgttacttggattagaaatgccactactggt
ttaggtaccggcgaacgagcctatattgaggctcgtgaaaaacttgtccaacctgcgatc
gagcagatgatggctgctcgagggctcgaaactcctccccggacacctgtcatcggtgtc
gccttggccggtggtggttaccgtgcaatgcttacagggttgggtggtatcatgggcatg
atgaatgagagtacggaagcgtcccaaagcgagactggtggttggcttgacggcgtaagc
tactggtctggtctgagcggtggaagttgggcaactgggtctttcatgtcgaatgggggt
cagttgcccacaactcttcttgaaaacctctggaacatcgattccaatctcgtctttcca
gatgacggcaaactttcattctacactaatctttacactgagaccaacgccaaatcagac
ctcggtttcccagttcaaattactgatatttggggtcttgccattggctcccacgtttta
cccgagccttaccagctctccaacactcctaatctcactttttctagccttccctctgtc
gtcgctgccttgggcaacgcaagcttgcccatgcccatcattgtcgcagctgaccggaaa
agacgagaggctggagagcttgtcattgccgaaaatgcaactgtctgggagtttactcca
tacgagtttggttcttgggcttttggtagccaatacaagagccctggtgctttcacccct
attgaatatctcggtacttcagtggacgatggctcacctaacggtacctgttggaagggc
tttgaccagttgtcctttgtcatgggaacttctgcgactcttttcaatggtgcctttctc
gaacttaacggcacagacagcggtcttcttaccaatttaatcactgccttccttgcggat
ctgggagaggaccaagctgatatttcccgtatccccaatagtttctccaattacaactcg
ggggagaaccccatctacaacctcacttacatcaccctcgtcgatgccggagaaaccaac
cagaacatacccctcgaacctttgctcgttcccacccgtgatgttgacgcgattgtggca
tttgactcttcctacgattctgactatatttggccaaacggcactgctttgaggactacc
tacgagcgagccaagattttagctgagcacgagaacacaagggtgttaatgcccgaggtc
cctagcatgaacggctttgtcaatggtggttacaactcaaggcctactttctttggctgt
aacgataccaccactcctgtgatcatctacataccttcttacccatggagctttgctgcc
aatacttctacttaccaactttcgtacgagaataatgaagccaacgaaatgttgctcaac
ggtatgcgctctctcactctcaaccactctgtccccacctggcccacttgctttgcttgt
gctcttaccgaccgctccttcatgtacacctccgagaaccgatccaccacctgtcaagag
tgttttgacacttggtgttgggctggtgacgacaacaccaccgagcctgcgaattatgag
cctgtaatcaacagtgttccgccctggttgatcgccaacaacctgagtatcggcatggcc
gatgctcctgggagcaacgaatccactgctggcacagcgtccagtggtgcagcgaagatg
ggtgtgggcatgggtatggtcgctctcactgctggtttgggcttgatgctttag

DBGET integrated database retrieval system