KEGG   Cryptococcus neoformans JEC21: CNM02410Help
Entry
CNM02410          CDS       T00243                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cne00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CNM02410
Enzymes [BR:cne01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CNM02410
Exosome [BR:cne04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CNM02410
  Exosomal proteins of colorectal cancer cells
   CNM02410
  Exosomal proteins of bladder cancer cells
   CNM02410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13:join(725524..725663,725766..725779,725856..725874,725926..725989,726043..726182,726232..726300,726347..727080,727130..727193,727243..727477)
Genome map
AA seq 492 aa AA seqDB search
MKFSSKLSLALVAALPNLASVLASDVLDLTESTFQKEIAGEDLALVEFFAPWCGHCKNLA
PHYEEAATELKEKNIKLAKVDCTVEQGLCGEFGVNGYPTLKVFRNGSPTDYAGTRKADGI
ISYMTKQSLPAISDVTPESHDTFIKSDNVVLVAYGDDAHPVPEAFKQYAKGARDSYLFGQ
YLSNDLPSIPENPSLPAIVLYKDFDEGYAVFPSGEIAHADVDELSEFVKQNSIPLFDEIS
PENFGSYAEQGIPIAYLFVDPNEASAREKLVEELKPLAKELKGIVNFVYIDAIKFIDHGK
SLNLPGDSWPAFVIQDLADQTKFPLTSKATAENIKDFVKKYVVGEISPSIKSEPIPATQG
PVYKLVADDWDNVYGDESKDVFAEFYAPWCGHCQRLAPIWDTLGEKYAGNNNIIIAQMDA
TENDIPPSAPFRVQGFPTLKFRPAGSSEFIDYTGDRSLDSLVEFVETNRKSDADVAEEEW
EDEDETPEHDEL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctcttcaaagctctccctcgccctcgtggccgccctccccaacctcgcctcc
gtcttggccagcgacgtcctcgatttgaccgagtctaccttccagaaggagattgccggt
gaagacttggctttggttgagttctttgctccttggtgcggtcactgtaagaaccttgca
ccccactacgaggaagccgctaccgagctcaaagagaagaatatcaagcttgccaaggtc
gactgtaccgttgagcaaggtctttgcggcgagtttggtgtgaatggatacccaacgttg
aaggtgtttaggaacggttcccctaccgactatgctggtaccaggaaagccgacggtatc
attagctacatgactaagcagagcctccccgccattagcgatgtaacccctgagtctcat
gacacgtttatcaagtctgacaatgttgtcctcgttgcctacggtgacgatgcccatcct
gtccctgaagccttcaagcagtacgccaagggcgcccgagactcatacctcttcggccaa
tacctttccaacgaccttccttctatccccgagaacccctctcttcccgctattgtcctc
tataaggactttgacgaaggttatgcagtcttcccgtctggcgagatcgcccatgccgat
gttgacgagctcagcgagtttgtcaagcaaaactccatccctctctttgacgaaatctct
cccgaaaactttggctcttatgccgaacagggtatccccatcgcatacctctttgtcgac
cccaacgaggcttctgcccgtgaaaagcttgtcgaggaactcaagccccttgccaaagag
ctcaagggtattgtcaactttgtttacattgacgctatcaagtttatcgaccatggcaag
tctctcaacctcccaggtgactcttggcctgcctttgtgattcaagaccttgccgaccag
accaaattccctttgaccagcaaggccaccgctgaaaatattaaggactttgtcaagaag
tacgttgtcggtgagatttctcctagcatcaagtctgagcctattccggccacccaaggt
cctgtttacaagcttgttgccgacgactgggacaacgtttacggcgatgagtccaaggat
gtttttgccgagttttacgctccttggtgcggtcattgccaacgtttggctcccatctgg
gacactctcggtgagaagtacgccggtaacaacaacatcatcattgcccaaatggacgcc
accgagaatgacattcccccttctgcccccttccgagtccaaggcttcccgaccctcaaa
ttccgacctgccggttcttctgaattcattgattacactggcgacaggagcctcgacagc
cttgttgagtttgtagagactaacaggaagagcgatgctgatgtcgccgaggaggagtgg
gaggatgaggacgagactcctgagcacgatgagttgtag

DBGET integrated database retrieval system