KEGG   Cryptococcus neoformans var. neoformans JEC21: CNM02410Help
Entry
CNM02410          CDS       T00243                                 

Definition
(RefSeq) hypothetical protein
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cne00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CNM02410
Enzymes [BR:cne01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CNM02410
Chaperones and folding catalysts [BR:cne03110]
 Protein folding catalysts
  Protein disulfide isomerase
   CNM02410
Membrane trafficking [BR:cne04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    CNM02410
Exosome [BR:cne04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CNM02410
  Exosomal proteins of colorectal cancer cells
   CNM02410
  Exosomal proteins of bladder cancer cells
   CNM02410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_8 Thioredoxin_7 Thioredoxin_2 AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 3255063
NCBI-ProteinID: XP_568417
UniProt: Q5K7H6
Position
13:join(725524..725663,725766..725779,725856..725874,725926..725989,726043..726182,726232..726300,726347..727080,727130..727193,727243..727477)
Genome map
AA seq 492 aa AA seqDB search
MKFSSKLSLALVAALPNLASVLASDVLDLTESTFQKEIAGEDLALVEFFAPWCGHCKNLA
PHYEEAATELKEKNIKLAKVDCTVEQGLCGEFGVNGYPTLKVFRNGSPTDYAGTRKADGI
ISYMTKQSLPAISDVTPESHDTFIKSDNVVLVAYGDDAHPVPEAFKQYAKGARDSYLFGQ
YLSNDLPSIPENPSLPAIVLYKDFDEGYAVFPSGEIAHADVDELSEFVKQNSIPLFDEIS
PENFGSYAEQGIPIAYLFVDPNEASAREKLVEELKPLAKELKGIVNFVYIDAIKFIDHGK
SLNLPGDSWPAFVIQDLADQTKFPLTSKATAENIKDFVKKYVVGEISPSIKSEPIPATQG
PVYKLVADDWDNVYGDESKDVFAEFYAPWCGHCQRLAPIWDTLGEKYAGNNNIIIAQMDA
TENDIPPSAPFRVQGFPTLKFRPAGSSEFIDYTGDRSLDSLVEFVETNRKSDADVAEEEW
EDEDETPEHDEL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctcttcaaagctctccctcgccctcgtggccgccctccccaacctcgcctcc
gtcttggccagcgacgtcctcgatttgaccgagtctaccttccagaaggagattgccggt
gaagacttggctttggttgagttctttgctccttggtgcggtcactgtaagaaccttgca
ccccactacgaggaagccgctaccgagctcaaagagaagaatatcaagcttgccaaggtc
gactgtaccgttgagcaaggtctttgcggcgagtttggtgtgaatggatacccaacgttg
aaggtgtttaggaacggttcccctaccgactatgctggtaccaggaaagccgacggtatc
attagctacatgactaagcagagcctccccgccattagcgatgtaacccctgagtctcat
gacacgtttatcaagtctgacaatgttgtcctcgttgcctacggtgacgatgcccatcct
gtccctgaagccttcaagcagtacgccaagggcgcccgagactcatacctcttcggccaa
tacctttccaacgaccttccttctatccccgagaacccctctcttcccgctattgtcctc
tataaggactttgacgaaggttatgcagtcttcccgtctggcgagatcgcccatgccgat
gttgacgagctcagcgagtttgtcaagcaaaactccatccctctctttgacgaaatctct
cccgaaaactttggctcttatgccgaacagggtatccccatcgcatacctctttgtcgac
cccaacgaggcttctgcccgtgaaaagcttgtcgaggaactcaagccccttgccaaagag
ctcaagggtattgtcaactttgtttacattgacgctatcaagtttatcgaccatggcaag
tctctcaacctcccaggtgactcttggcctgcctttgtgattcaagaccttgccgaccag
accaaattccctttgaccagcaaggccaccgctgaaaatattaaggactttgtcaagaag
tacgttgtcggtgagatttctcctagcatcaagtctgagcctattccggccacccaaggt
cctgtttacaagcttgttgccgacgactgggacaacgtttacggcgatgagtccaaggat
gtttttgccgagttttacgctccttggtgcggtcattgccaacgtttggctcccatctgg
gacactctcggtgagaagtacgccggtaacaacaacatcatcattgcccaaatggacgcc
accgagaatgacattcccccttctgcccccttccgagtccaaggcttcccgaccctcaaa
ttccgacctgccggttcttctgaattcattgattacactggcgacaggagcctcgacagc
cttgttgagtttgtagagactaacaggaagagcgatgctgatgtcgccgaggaggagtgg
gaggatgaggacgagactcctgagcacgatgagttgtag

DBGET integrated database retrieval system