KEGG   Cryptococcus neoformans JEC21: CNM02410Help
Entry
CNM02410          CDS       T00243                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:cne04141]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13:join(725524..725663,725766..725779,725856..725874,725926..725989,726043..726182,726232..726300,726347..727080,727130..727193,727243..727477)
Genome map
AA seq 492 aa AA seqDB search
MKFSSKLSLALVAALPNLASVLASDVLDLTESTFQKEIAGEDLALVEFFAPWCGHCKNLA
PHYEEAATELKEKNIKLAKVDCTVEQGLCGEFGVNGYPTLKVFRNGSPTDYAGTRKADGI
ISYMTKQSLPAISDVTPESHDTFIKSDNVVLVAYGDDAHPVPEAFKQYAKGARDSYLFGQ
YLSNDLPSIPENPSLPAIVLYKDFDEGYAVFPSGEIAHADVDELSEFVKQNSIPLFDEIS
PENFGSYAEQGIPIAYLFVDPNEASAREKLVEELKPLAKELKGIVNFVYIDAIKFIDHGK
SLNLPGDSWPAFVIQDLADQTKFPLTSKATAENIKDFVKKYVVGEISPSIKSEPIPATQG
PVYKLVADDWDNVYGDESKDVFAEFYAPWCGHCQRLAPIWDTLGEKYAGNNNIIIAQMDA
TENDIPPSAPFRVQGFPTLKFRPAGSSEFIDYTGDRSLDSLVEFVETNRKSDADVAEEEW
EDEDETPEHDEL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctcttcaaagctctccctcgccctcgtggccgccctccccaacctcgcctcc
gtcttggccagcgacgtcctcgatttgaccgagtctaccttccagaaggagattgccggt
gaagacttggctttggttgagttctttgctccttggtgcggtcactgtaagaaccttgca
ccccactacgaggaagccgctaccgagctcaaagagaagaatatcaagcttgccaaggtc
gactgtaccgttgagcaaggtctttgcggcgagtttggtgtgaatggatacccaacgttg
aaggtgtttaggaacggttcccctaccgactatgctggtaccaggaaagccgacggtatc
attagctacatgactaagcagagcctccccgccattagcgatgtaacccctgagtctcat
gacacgtttatcaagtctgacaatgttgtcctcgttgcctacggtgacgatgcccatcct
gtccctgaagccttcaagcagtacgccaagggcgcccgagactcatacctcttcggccaa
tacctttccaacgaccttccttctatccccgagaacccctctcttcccgctattgtcctc
tataaggactttgacgaaggttatgcagtcttcccgtctggcgagatcgcccatgccgat
gttgacgagctcagcgagtttgtcaagcaaaactccatccctctctttgacgaaatctct
cccgaaaactttggctcttatgccgaacagggtatccccatcgcatacctctttgtcgac
cccaacgaggcttctgcccgtgaaaagcttgtcgaggaactcaagccccttgccaaagag
ctcaagggtattgtcaactttgtttacattgacgctatcaagtttatcgaccatggcaag
tctctcaacctcccaggtgactcttggcctgcctttgtgattcaagaccttgccgaccag
accaaattccctttgaccagcaaggccaccgctgaaaatattaaggactttgtcaagaag
tacgttgtcggtgagatttctcctagcatcaagtctgagcctattccggccacccaaggt
cctgtttacaagcttgttgccgacgactgggacaacgtttacggcgatgagtccaaggat
gtttttgccgagttttacgctccttggtgcggtcattgccaacgtttggctcccatctgg
gacactctcggtgagaagtacgccggtaacaacaacatcatcattgcccaaatggacgcc
accgagaatgacattcccccttctgcccccttccgagtccaaggcttcccgaccctcaaa
ttccgacctgccggttcttctgaattcattgattacactggcgacaggagcctcgacagc
cttgttgagtttgtagagactaacaggaagagcgatgctgatgtcgccgaggaggagtgg
gaggatgaggacgagactcctgagcacgatgagttgtag

DBGET integrated database retrieval system