KEGG   Cryptococcus neoformans JEC21: CNN01190Help
Entry
CNN01190          CDS       T00243                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:cne03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:cne03420]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14:join(360295..360413,360493..360609,360663..360791,360842..361057,361107..361236,361275..361566,361630..361890,361949..362130)
Genome map
AA seq 481 aa AA seqDB search
MVQPFVSAPKKDATKQASPTLALDIFLDNQHQSYFEELYRLLPPVCRQIILHALWSHHPL
RTVDVKLLLQMDVHAPLEECDEVMRPAIDRKVLHPMHYKKQRMQWSLNDSFKKGLRNALT
GLGTSNSFGVPFERHQATDLDLPSEDELVAYGEDTFESILKYMVSSGLGTEFSGSRPQPE
VLQLLHTSGLMTDSVDMNGRNPNINRLTITSKGFQFLLEKRQTQLWEILMYYLSAKEANS
ERSSEVLSMFFSLGCMQLGQDYSASNSFPGAQEALDDLAQYGFIYKSSPDSDQFWPTHLA
TSLCSGDASAIQSQSADDKRFLILETNYKIYAYTSNELEIAILNLFVDIRIRYPNLVVGK
LDRQHVKAAMEKGISARQIIAYLSSHAHPQMYNSPPPLLHPTIVDQLYLWDRERNRLQTE
ETVMYEFFSKELFDDTVNEAKANAALQHAAISQKLLFIEPHTKPAITEFVKQRQNVLRGG
Y
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggtacaaccattcgtttcagctcccaagaaggatgcgaccaaacaggcatcgccgaca
ttggctcttgacatctttctcgataaccagcaccagtcgtattttgaggagctctacaga
ttactaccgccagtatgccgtcaaattattctccatgccttgtggtcccatcatccatta
cggacggtcgatgtcaagctgcttctccagatggatgtccatgctcctttagaagaatgc
gacgaggtcatgcgaccagctatagacaggaaggtcctccatccaatgcattataagaaa
cagagaatgcagtggtccttgaatgattctttcaagaagggcctgagaaatgccttgaca
ggattaggaacatcaaattcgttcggtgtaccctttgaaagacatcaggcaactgacctt
gatcttccctccgaggacgagctcgtggcgtatggcgaggatacgtttgagtctattctc
aaatacatggtgtcttccggtctcggtacagaattctctggatccagaccacagcctgag
gtcctccagctcttacataccagcggcctcatgacggattctgtcgatatgaacggaaga
aatcccaatataaatcggctcacaatcacttccaaaggctttcaatttttgctcgagaag
agacagactcagttgtgggagatactcatgtactacttgagtgccaaagaagcaaactct
gaacggtcatccgaggtcttgtcaatgttcttctccctcggatgtatgcaactaggacaa
gactattccgcgtccaactccttccctggcgctcaagaagctctcgacgacctcgcccaa
tacggtttcatttacaaatcatcgcctgacagcgatcaattttggcccacccaccttgcc
acctctttgtgttccggcgacgcttctgccatccagtctcagagtgcagacgacaagcgt
ttcctaatattggaaaccaattacaaaatttacgcatatacttcaaacgagctcgagatc
gccatccttaatctctttgtcgacattcgcattcggtaccccaacctcgttgtaggaaaa
ctcgatcgtcagcacgttaaagccgccatggaaaagggtatctcagcccggcagatcatc
gcctatttgtccagtcatgcccatccacaaatgtacaactctcccccaccattattacat
cccaccattgtcgatcaactttatttatgggatcgagagaggaatagattacagacggaa
gagactgttatgtacgaattcttcagcaaagaactctttgacgatactgtcaatgaagcc
aaagcgaatgcggctctacagcatgccgctatatctcaaaaactattattcatcgagcca
catacgaagcctgcgatcacagaattcgtcaaacaaagacagaacgtccttagagggggc
tattag

DBGET integrated database retrieval system