KEGG   Calditerrivibrio nitroreducens: Calni_0182Help
Entry
Calni_0182        CDS       T01364                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cni  Calditerrivibrio nitroreducens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cni00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
181302..182270
Genome map
AA seq 322 aa AA seqDB search
MAYPIERGRRLRRNEKIRRMVRETVLSLDDLIYPLFVVEGEGIKKEVSSMPDVYQMSIDN
IVKECIELERLGLQSIILFGIPNHKDELGSEAYNDNGVIQQAIRAIKQNTGLYIITDVCM
CEYTSHGHCGIIKDGDVDNDTTLKYLAMEALSHAKAGADMVAPSDMMDGRVAVIRDILDD
NGFEHIPIMSYSVKYASAFYGPFREAAESTPQFGDRRSYQMDPANRREALREARYDLEEG
ADILMVKPALPYLDIIRDLRETFDLPIAAYNVSGEYSMIMAAVRNGWVDKDRVIMESLTS
IKRAGADLILTYFAKEVARILG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcatacccaatagaaagaggtagaagattaagaagaaatgaaaaaataagacggatg
gtaagggaaactgtattatctctggatgatcttatataccctttattcgttgtggaaggg
gagggtataaaaaaagaggtctcctccatgccagatgtttaccagatgagtatcgacaat
attgtcaaagaatgtatagagcttgaaaggctcggtttgcaatcgattatattattcggg
ataccaaaccataaagatgagcttggtagtgaggcttacaatgataatggagttatacag
caggcgatcagagccataaaacagaatacaggattgtatataattactgatgtctgtatg
tgtgaatatacctctcatgggcattgtggaattataaaagatggggatgtggataatgat
acaacccttaaataccttgctatggaggccctgtcgcacgctaaagcaggtgctgatatg
gtggctcccagtgatatgatggatggaagggtggcggttattagagatatcttggatgat
aatggatttgagcatatcccaataatgagctattcagtcaaatatgcatctgcattttat
ggacctttcagggaagctgcggaaagtacccctcagtttggtgacagaagaagctatcag
atggatccagctaatagacgggaggctctaagagaagcaagatacgatctcgaggaaggg
gctgatatactgatggttaaacctgctctgccctatcttgatataataagagatctaagg
gaaacttttgacctgccgattgcggcgtacaacgtaagtggtgaatattcgatgataatg
gccgccgtacgaaatgggtgggttgataaggatagggttattatggaatccctcacttcg
ataaaaagagccggagcggatctaattttaacgtactttgcaaaagaggttgccaggatt
ttgggctga

DBGET integrated database retrieval system