KEGG   Calditerrivibrio nitroreducens: Calni_0328Help
Entry
Calni_0328        CDS       T01364                                 

Definition
phenylalanyl-tRNA synthetase subunit alpha (EC:6.1.1.20)
Orthology
K01889  
phenylalanyl-tRNA synthetase alpha chain [EC:6.1.1.20]
Organism
cni  Calditerrivibrio nitroreducens
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:cni00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
334896..335906
Genome map
AA seq 336 aa AA seqDB search
MEISKEIYEYKKEIVDAENLEQLYQVWVKYLGKKGLISLLNKELKNVPEEKRSEFGRIIV
GLREDFEKLYQEREIELKKAEINDKIEKERIDVTLPAFPLNYGGLHPITQVYFEIVDIFK
SMGYELATGPEIELDFYNFEALNIPKEHPARDMQDTFYIDDEVLLRTHTSPVQIRTMEMK
EPPIKIIAPGKVYRCDSDVTHTPMFHQVEGLLIDTDTTFGDLKGALITFIHRLFGKDIPV
RFRPSFFPFTEPSAEVDMGCVICGGKGCRVCKGTGWLEILGSGMVHPKVLESVGYDSEKY
RGFAFGMGIERITMLKFGIDDLRLFFDNNIKFLRQF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggagataagtaaagagatatatgaatacaaaaaagagattgttgacgcagaaaattta
gaacaactataccaggtatgggtaaaataccttgggaaaaagggtttgatttctctgttg
aataaggaattgaagaatgttcctgaagaaaagagatcagagtttgggcggattatcgtg
gggttgagggaggattttgaaaaactctaccaggaaagagaaattgagctaaaaaaagct
gagattaatgacaagattgaaaaagagagaattgatgttactctaccagcatttccgtta
aactatggtggattgcatcccattacacaggtatactttgagatagtggatatttttaag
tcgatgggttatgaattggccaccggtccagagatagagcttgatttttacaattttgaa
gcgttgaatattccaaaagaacatccggcaagggatatgcaggatacattttacatagac
gatgaagtattactcaggacacatacatcaccagtacagatcagaactatggagatgaaa
gagccaccgataaaaattatagcaccaggtaaggtatatcgatgtgacagtgatgtgact
catacaccaatgtttcatcaggtggaaggactgcttattgatactgatactacttttggg
gatctaaaaggagcgctgatcacatttatacatagactatttggaaaagatataccggta
aggtttagaccaagcttttttccattcaccgagccgtccgcagaagtggatatggggtgt
gtaatctgtggaggcaaagggtgtagagtgtgcaagggtactggctggctggaaattctt
ggatctgggatggttcatccaaaggttctggaatctgttggctatgattcggaaaagtac
agaggttttgcgtttgggatgggaatcgaaaggattacaatgcttaaatttggtattgat
gatctaagattgttttttgataataatataaagtttttgagacaattttga

DBGET integrated database retrieval system