KEGG   Calditerrivibrio nitroreducens: Calni_0353Help
Entry
Calni_0353        CDS       T01364                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cni  Calditerrivibrio nitroreducens
Pathway
cni00020  Citrate cycle (TCA cycle)
cni00640  Propanoate metabolism
cni00660  C5-Branched dibasic acid metabolism
cni01100  Metabolic pathways
cni01110  Biosynthesis of secondary metabolites
cni01120  Microbial metabolism in diverse environments
cni01130  Biosynthesis of antibiotics
cni01200  Carbon metabolism
Module
cni_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cni_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cni00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Calni_0353
   00640 Propanoate metabolism
    Calni_0353
   00660 C5-Branched dibasic acid metabolism
    Calni_0353
Enzymes [BR:cni01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Calni_0353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: ADR18266
JGI: Calni_0353
UniProt: E4TK15
Position
362480..363661
Genome map
AA seq 393 aa AA seqDB search
MNIHEHQAKEIFRKYGVPTPKGYVAFKAENAVKIAQQLGGEKEVWVIKAQIHAGGRGKAG
GVKIARSTEEVGLIAKSLLGKTLVTHQTGPEGKVVRRIYIEEGLDIEKEFYLSILLDRAK
EMPVIIASSEGGMEIEEVAAKSPEKIVRIHLDPLIGFQPFHARKLAFALNLPREEVNRFV
NFVQALYKVYEDYDAELVEINPLIRTTDKKFIALDAKVSFDNNALFRQPEAQAMRDLTEE
EPTEIEASNYNLSYVKLDGNVGCMVNGAGLAMATMDIIKHEGGNPANFLDVGGGATAETV
AKGFEIILRDPNVKSIFVNIFGGIVRCERVANGIVEAAKVTEVRVPVVVRLDGTNAEEAA
EILKNCGIKNIIPAKDMKDGAVKAVKAAKGELI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgagcatcaggcaaaggagatttttcgtaagtatggtgtaccaacacca
aaaggttatgtggcctttaaagcagaaaatgccgtaaagattgcacagcaactgggcggt
gaaaaagaggtttgggttataaaagctcagattcatgctggtggtagaggtaaggctggt
ggtgtgaaaattgcaagatctacggaagaagttggtttaattgcgaaatcacttttgggt
aaaacacttgttactcatcaaactgggccagaagggaaggtggtacgcagaatttatata
gaagaagggctggatattgaaaaagagttttatttaagtatccttctggatagagcaaag
gagatgcctgttattattgcttcatctgaaggtggtatggagatagaagaggtggctgct
aaatctcctgaaaagatcgttaggatacatctggatcctttgataggatttcaacctttt
catgccagaaaacttgcttttgcattgaatttaccgagagaggaagtaaataggtttgtt
aattttgtgcaggctctttataaggtttacgaggattacgatgcagaattggtggagata
aatccactcatcagaactaccgacaaaaaatttatagcccttgatgcaaaggtatctttt
gataataatgcactttttagacagccggaagctcaggctatgagggatctcaccgaagaa
gagcccactgagatagaagcatcaaactacaatttgagctatgtaaaattggatggtaat
gtgggttgtatggtgaatggtgcaggtcttgctatggctactatggatattatcaaacat
gagggtggtaatcctgcaaatttccttgatgttggtggtggtgctacagcagaaacggtc
gctaaggggtttgaaataatactgagggatccaaacgttaaatctatatttgtaaatata
tttggtggaattgttagatgtgaaagggtcgcaaatggtattgtggaagctgcaaaggtt
actgaagtaagggttcctgttgtggtaaggcttgatgggacaaatgctgaagaagcagct
gagattctaaaaaattgtgggattaagaatataatccccgcaaaagatatgaaagatggt
gctgtgaaagctgtaaaagcagctaagggggaattgatatga

DBGET integrated database retrieval system