KEGG   Calditerrivibrio nitroreducens: Calni_0746Help
Entry
Calni_0746        CDS       T01364                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cni  Calditerrivibrio nitroreducens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cni00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(780711..782075)
Genome map
AA seq 454 aa AA seqDB search
MRVAIIGGGISGISTAFLLENLKNELNLDMEITIIEKRLRWGGSIETSREDGFIVEAGPN
GFLDSKPHTLELLSMAGLSNNLVKSNDLARKRYIMRNGILHRLPENPPMFFKTKLLSFSA
KMRILSEYFIQKSVLEDESVADFARRRLGKEALEYLISPMVSGIFAGDPEKMSLRSCFPV
IRDLEINYGGLFKGMIKKKGKKSGPSGPGGILTSYKNGLDNMITDLLESTSITKMLNTEV
FSIDKKINRYILNTNKGIMEFDKIFINAPAYAVSQMLSVLDKDLSRDLNNITYPPVFVAG
FIFKPEDLEDPLDGFGYLIPHSENKRILGALFDSSIFPDRTRDGYKIVRTIMGGDKNRWI
IEKSDDELIRMAFDDIKETLKIKREPYKIKYFRWEKAIPQYYIGHHKIVEKVEEFYKKFD
DIFIGGNILYGVGINDCTRTSFMNVDRFKNLLNK
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgagagtagccataataggaggcggaatatcagggatatccaccgcttttttattggaa
aatttgaaaaatgaactgaatctggatatggaaataacaatcatagaaaagagattgagg
tggggcggttcaatagagacctcacgggaagatgggttcatagtagaagcagggccaaat
ggttttttagacagcaaaccccatacccttgaacttctatcaatggcaggattaagcaac
aatcttgtcaaaagtaatgacttagcaagaaaaagatatatcatgcgcaatgggatttta
catagattacctgaaaatccaccaatgtttttcaaaactaagctactctccttctcagca
aaaatgaggatactatccgaatatttcatacaaaaaagtgtccttgaagatgaatctgtg
gcagactttgccagaagaagattggggaaagaagctcttgaataccttatcagcccaatg
gtctctggcatttttgcaggtgatcccgaaaagatgagcttaagatcctgtttccccgta
ataagggatctggaaataaattatggtggcctttttaaagggatgataaagaaaaaaggg
aaaaaaagtggcccatcaggccccggcggaatccttacttcatacaaaaatggactggat
aatatgataacagatttactcgaatccacaagcatcacaaagatgttgaatacggaagta
ttttcaatagataaaaaaataaacagatatatattaaataccaataaaggcatcatggag
ttcgataaaatattcataaatgccccggcctatgctgtttcccaaatgctctcagttctt
gataaagatctatccagggatctaaataacatcacttaccctcctgtttttgttgctggg
tttatattcaagccggaggatctggaagatcctctggatggcttcggctatctgataccc
cattcagagaataaaagaattttgggagcactgtttgattcttcgatattccctgataga
acaagggatggatacaaaatcgttagaacgataatgggtggagataaaaatagatggata
attgaaaaatccgacgatgaacttatcaggatggctttcgatgacataaaagaaacttta
aaaataaaaagagagccttacaaaataaaatattttagatgggaaaaagcaatcccccag
tactacatcgggcaccacaaaatagttgaaaaggttgaagagttctataaaaaatttgat
gacatttttatcggtggtaatatcttatatggtgtgggtataaatgattgcaccagaaca
agctttatgaatgtggatagatttaaaaatctcttaaacaaataa

DBGET integrated database retrieval system