KEGG   Calditerrivibrio nitroreducens: Calni_0874Help
Entry
Calni_0874        CDS       T01364                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cni  Calditerrivibrio nitroreducens
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cni00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Calni_0874
Enzymes [BR:cni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Calni_0874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(923368..923862)
Genome map
AA seq 164 aa AA seqDB search
MADVLLGLGSNIPPKSKNLKNAIKLLSKHCMIEAVSNIYSSLSLLKDNQEDYFNIVVMVK
TDFSPLALLKFLKNIEISLGRIDTGRWNSRIIDIDILDYNNQIIDMKELAVPHLEMHKRS
FVLYPLRDIMPDYKHPLFKKDIITMINELDDDLNITILGRLHWQ
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgttttattaggcctgggtagtaatataccaccaaaatctaaaaacctaaaa
aatgccattaaattgttatccaaacactgcatgatagaggcagtttctaatatctactcc
tccctgtcccttttaaaagataatcaggaggattatttcaatattgttgtaatggttaaa
accgatttttctcctcttgctctattaaaatttttaaaaaatatagaaatatctttgggc
agaatagatacaggaagatggaacagtagaataatcgacatagatatattagactataat
aaccagataatagatatgaaagagcttgccgtaccacacctggaaatgcataagagaagc
ttcgtcttataccctctcagggatattatgccagactacaaacacccattatttaaaaaa
gatataatcaccatgataaacgaattggatgatgatctaaatatcacaatattagggagg
ttacattggcaatag

DBGET integrated database retrieval system